KEGG   Burkholderia sp. CCGE1001: BC1001_0999Help
Entry
BC1001_0999       CDS       T01424                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BC1001_0999
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BC1001_0999
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BC1001_0999
    1.1.1.-  
     BC1001_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADX54446
UniProt: E8YHI5
LinkDB All DBs
Position
1:complement(1119669..1120751)
Genome map
AA seq 360 aa AA seqDB search
MRALQWHGPRDLRLVELDTPRAGPGQVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
GRTAPLTLGHEFCGTVVEVGAGVTGLSLGDRVAVEPEYHCKQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDEVSLEQAAVMEPAAVALHALRRAELRLGDTCAVFGL
GPIGLLLISLAKLQGATTIVAVDVSRERLAAASQLGATHALDAGALDAPALRDALREAAG
GLGVDVSFEAAGLPATFEAAMQGLRKGGRVVMVGLMPHANFDAFRAVNDELTFTASVGYR
HAYGDLLRIVGSGALDLTSIVTRVVSLDDAVAEGFDALLADRTQIKILVSPAKPPSAINA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctacaatggcatggcccccgggacctccgactggtcgagctcgacacgcca
cgcgccgggcccgggcaggtgcggatcgccgttgcctattgcggcatttgcggcagcgat
ctccacgaatatgcagacgggccgcacgcgattccagtcgatgcgccacatcctttgtca
ggccgtaccgcgccgctgacgttgggccacgagttctgcggcacggtcgtcgaagtcggc
gctggtgtgaccgggctgtctttgggcgatcgcgtcgcggtcgagcctgagtatcactgc
aagcagtgcgcatactgccgctcaggctcgtacaacctgtgcgtgtcgatgggcttcgct
gggctcatgggcgacggcgggatggccgacttcgcggtcgtgccggcttacatgctgcac
cggctgcccgacgaagtcagtctcgaacaggccgcagtgatggagccggctgccgtcgcg
ctgcatgcgctgcgacgcgcagagctgcggctcggcgacacctgtgcggttttcggcctt
gggccaattggtcttctgctgatctctctcgcaaagctacagggcgcgacgacgattgtc
gcggtcgatgtgtcgcgcgagcggctcgccgccgcgtcacagctcggcgcgacgcatgcg
ctggacgcgggtgcactcgacgcacccgccttacgcgatgcccttcgcgaagcggcgggc
gggctcggcgtcgacgtgagcttcgaggcggccggcctgccggctaccttcgaggcggcg
atgcagggcctgcgcaagggcggccgcgtcgtgatggtgggcttgatgccacatgcgaat
ttcgacgccttccgtgcggttaacgatgaactgacattcacagcgagcgtcgggtaccgt
cacgcttacggggatctgctacgcatcgtgggttcaggtgccctcgacctgacgtcgatc
gttacccgcgtagtgtcgctcgacgacgcggtggccgagggattcgacgcgctccttgcg
gataggacgcagatcaagattcttgtatcaccagcgaagccgccgtctgctatcaacgcg
tga

DBGET integrated database retrieval system