KEGG   Burkholderia sp. CCGE1001: BC1001_1000Help
Entry
BC1001_1000       CDS       T01424                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bug  Burkholderia sp. CCGE1001
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like LacY_symp
Motif
Other DBs
NCBI-ProteinID: ADX54447
UniProt: E8YHI6
LinkDB All DBs
Position
1:complement(1120753..1122054)
Genome map
AA seq 433 aa AA seqDB search
MTSHPSVKSAWTYENRLLLILFATFGFVFFDRLALSFLFPFMSAELHLSNGQLGMVSSAL
ALTWALSGAMTGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFTSLIAFRALMGISEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
IPGFLIAFCIWRWVREVPSGGVRRTQTQSPDAPVAGDGPVSRFAVLKERNVLLCVLISCF
FLTWFVVIISFAPVFLVESRHFSPSAMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIA
FALIAAACPIAMMRVDSVWALGTLVFATYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADRYGLQFAMWTSSAGAVLACLLSFGLVETAPAMLRKQALAG
ARTRLDTQNIGGQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcacccttccgtcaaatcggcatggacttacgagaacaggctgctgctcatt
cttttcgcgacgttcggcttcgtgtttttcgaccgccttgccctgtcgtttctgttcccg
ttcatgtcggccgaattgcacctgtcgaatggccagctcggcatggtgtcgtctgcactt
gcgctgacgtgggcgctgtcgggcgccatgaccggcgcatggtctgacgcgcgcggcacg
cgcaagccgcttttaattgctgcggtgttgggtttttccgtgtgctctgccctatccgga
ttggtcggcggcttcacgagcctgatcgctttccgggcgctgatgggcatctccgaaggg
cccgttctgccgctgtcgcaatcgctgatggtcgagagttcgacgccgagccgccggggc
ctgaatatgggcctgctgcaaggctcggccgccggactgcttggcgcgatgatcggcccg
ccggtcgtcattgggatcgccaccgcgtacggctggcgcgaagcattctacgtgtcatgc
attcccggctttctgatcgccttctgcatctggcgctgggtgcgggaagtgccatctggc
ggcgtgcggcgcacgcagacgcagagcccggatgcgcccgttgcgggcgacggtccagta
agccgcttcgccgtattgaaggagcgcaacgtcttgctgtgcgtgctgatcagctgcttc
ttcctcacctggttcgtcgtcatcatctcgtttgcgccggtctttctggtcgaaagccgg
cacttttctccgtccgcgatgggcgtggtgatgacctgcctcggcgctgcatgggtcttc
tggggcttcgcagttcccgcaatctccgaccggatcggccgcaagccgacgatgatcgct
ttcgcgctgatcgccgccgcctgcccgatcgcgatgatgcgtgtcgactcggtctgggct
ctcggcacgctcgtgtttgccacgtatacaggtctcgggtgcttcaccctcttcatggca
acgatcccggccgaaaccgttccgccgcgcgcgatcgccagtgcgctcgggctgatcatg
ggagcgggcgagcttatcggcggcttcgtcgcgccgaccgtagccggcttcgctgccgac
agatacggcctgcagttcgccatgtggacatcgtccgccggcgcggtgctcgcctgccta
ctgtcgttcggcctcgtcgaaacggcgcctgccatgctgcgcaaacaggcactcgctggc
gcgcgcactcgtctcgatacgcaaaacatcggagggcagtga

DBGET integrated database retrieval system