KEGG   Burkholderia sp. CCGE1001: BC1001_1500Help
Entry
BC1001_1500       CDS       T01424                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1001_1500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bug02000]
    BC1001_1500
Enzymes [BR:bug01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BC1001_1500
Transporters [BR:bug02000]
 Other Transporters
  Pores ion channels [TC:1]
   BC1001_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ADX54936
UniProt: E8YM46
LinkDB All DBs
Position
1:complement(1715856..1716593)
Genome map
AA seq 245 aa AA seqDB search
MSLELYYWDGLQGRGEFVRLALEEAGADYVEVARGEPSEGLGTGAMMAVMKSRDEPYPPF
APPFLKDGDLVISQTANILFYLGPRLNLAPSVESLRYVANGLQLTIADMVTEAHDTHHPL
ASSLYYEDQKDAARARAHDFIDNRIPKFMNYFERVLKQNPAGDGFMVGDSLTYVDLSMFQ
LIDGLLYAFPRALARFADHYPRLAALHAAVMKRPKIAAYLQSERRIEHNEACIFRHYPEL
DKAAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggaactttactattgggacggtctgcaaggccgtggcgaatttgtgaggctg
gcactcgaagaagccggcgcggactatgtcgaagtggcgcgcggcgagccgtccgaaggt
ctcggcaccggcgcgatgatggcggtcatgaaaagccgcgacgaaccctacccgccgttc
gcgccgccgtttctgaaagacggcgacctggtgatctcgcaaacggcgaacatcctgttt
tatctcggcccgcgtctgaaccttgcgccctctgtggaaagcctgcgctacgtggcaaat
gggctgcagctcaccattgccgacatggtgaccgaggcgcacgacacgcatcacccgctg
gcatcgagcctctactacgaggatcagaaagacgccgcgagagcacgcgcccatgacttc
atcgacaaccggattccaaagttcatgaactatttcgagcgcgtgctgaaacagaatccg
gccggcgacggcttcatggtcggcgactcgctcacctacgtggacctctcgatgttccag
ctgatcgacggactgctttacgcctttccgcgcgcgctcgcgcgcttcgccgaccactat
ccgcggctcgccgccctgcatgccgcagtgatgaagcggccgaagatcgccgcttatctg
cagtcggagcgccgcatagaacataacgaggcgtgcatcttccggcactatcccgaactc
gacaaggcggcggcttga

DBGET integrated database retrieval system