KEGG   Burkholderia sp. CCGE1001: BC1001_3107Help
Entry
BC1001_3107       CDS       T01424                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00473  D-Alanine metabolism
bug00550  Peptidoglycan biosynthesis
bug01100  Metabolic pathways
bug01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC1001_3107
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BC1001_3107
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BC1001_3107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bug01011]
    BC1001_3107
Enzymes [BR:bug01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BC1001_3107
Peptidoglycan biosynthesis and degradation proteins [BR:bug01011]
 Precursor biosynthesis
  Amino acid ligase
   BC1001_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ADX56521
UniProt: E8YFY1
LinkDB All DBs
Position
1:complement(3535181..3536122)
Genome map
AA seq 313 aa AA seqDB search
MSSIDPNKFGKVAVLLGGNSAEREVSLNSGRLVLQGLRDAGVDAHPFDPAERPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIKYTGSGVLGSALGLDKFRTKLVWQQLGIPTPP
FEAVMRGDDYEARAKDIVAKLGLPLFVKPASEGSSVAVIKVKSADALPAALVEAVKYDRI
VVVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYIANDTQYLIPCGLTPAEET
RMKVLARRAFDVLGCTDWGRADFMLDADGNPYFLEVNTAPGMTDHSLPPKAARAVGISYQ
ELVVGVLALTLKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtatcgaccctaacaaattcggcaaggtggcagtgttgctcggcggcaattcg
gccgagcgtgaggtgtcgctcaattccgggcgcctcgtgctgcaaggtttgcgcgacgcc
ggcgtcgacgcgcatccgttcgatccggccgagcgtccgctagccgcgctgaaggacgaa
ggcttcgtgcgcgcgttcaatgcgctgcacggcggctacggcgaaaacggccagattcag
ggcgcgctggatttctacggcatcaaatacaccggcagcggcgtgctcggctcggcgctc
ggactcgacaaattccgcacgaaactcgtgtggcagcaactcggcattccgacgccgccg
ttcgaagccgtcatgcgtggcgacgactacgaagcgcgcgcgaaagacatcgtcgcgaag
ctcggtttgccgcttttcgtgaagccggccagcgaaggttcgagcgtcgcggtgatcaag
gtgaagagcgcggacgcgttgccggcggcgctcgtcgaagcggtgaagtacgaccggatt
gtcgtggtcgagaagagcatcgagggcggtggcgaatacaccgcatgcatcgcgggcgat
ctcgacttgcccgtgatccgcatcgtgccggccggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcagtatctgattccctgcggcctgacgccagccgaagaaacg
cgcatgaaagtgctggcgcgccgcgcgttcgacgtgctcggctgcaccgactggggccgc
gcggatttcatgctcgacgccgacggcaatccgtacttcctggaagtgaatacggcgccc
ggcatgacggaccattcgctgccgccgaaagcggcgcgcgcggtgggcatcagctatcag
gaactggtggtcggcgtgttggcgctgaccttgaaggattaa

DBGET integrated database retrieval system