KEGG   Burkholderia sp. CCGE1001: BC1001_3136Help
Entry
BC1001_3136       CDS       T01424                                 

Definition
(GenBank) glutamine amidotransferase of anthranilate synthase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01130  Biosynthesis of antibiotics
bug01230  Biosynthesis of amino acids
bug02024  Quorum sensing
Module
bug_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1001_3136
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BC1001_3136
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BC1001_3136
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BC1001_3136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADX56550
UniProt: E8YG10
LinkDB All DBs
Position
1:3575637..3576230
Genome map
AA seq 197 aa AA seqDB search
MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDDIAKLNPERICLSPGPSNPQHAG
ITLDVLREFSGKTPILGVCLGHQAIGEAFGGRVVRAQTIMHGKVSTIETDCKGVFADLPK
HFVVTRYHSLAIERESLPDCLEVSAWTEDGEIMGVRHKELAVEGVQFHPESILSEHGHAL
LENFVKQSKAKTAQRTA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcatgatcgacaattacgactcgttcacctacaacctggtgcagtacttcggc
gaactcggcgaagacgtgcgcacctatcggaacgacgaaatcacgctggacgacatcgca
aagctcaaccccgagcgaatctgcctgtcgcccggtccgagcaatccgcaacacgcgggc
atcacgctcgacgtgctgcgcgaattttccggcaagacgccaattctcggcgtgtgcctc
ggccatcaggccatcggcgaagcattcggcgggcgtgtggtgcgcgcgcaaaccatcatg
cacggcaaggtcagcacgatcgaaaccgactgcaaaggcgtgttcgccgatctgcctaag
catttcgtcgtgacgcgctatcactcgctcgccatcgaacgcgaatcgctgcccgattgc
ctcgaagtgtcggcgtggaccgaagacggcgaaatcatgggcgtgcgtcacaaggagctg
gcggttgaaggcgtgcagttccatccggaatccattctttccgaacacggccacgcgctg
ctcgagaacttcgtgaagcagtccaaagcgaagaccgcccaacgcaccgcctga

DBGET integrated database retrieval system