KEGG   Burkholderia sp. CCGE1001: BC1001_3606Help
Entry
BC1001_3606       CDS       T01424                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00500  Starch and sucrose metabolism
bug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1001_3606
Enzymes [BR:bug01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BC1001_3606
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BC1001_3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ADX57019
UniProt: E8YQ04
LinkDB All DBs
Position
2:complement(3616..5280)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIVYCLSVGSFMDANGDGVGDFKGLLRRLDYLQGLGVTTIWLMPFQPSPGR
DNGYDISDYYNVDPKYGTLGDFSEFTHACRERGLRVMIDLVVNHTSDQHPWFREARSDPD
SPYRDWYVWSGRQPPNAKDGVVFPGVQKSTWTFDKEAKRWYFHRFYEFQPDLNTANPYVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPQVRKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPNTDLEYFGDEGERLQMMFNFQLNQNTFYTLATGDTAPLKKALTATRPRPATA
QWGVFLRNHDELDLGRLTPEQRAAVFAAFAPDPDMQLYERGIRRRLAPMLAGDRRRLELA
YSLMLTLPGTPVFRYGDEIGMGDDLRLPERECARTPMQWSAEPQGGFTKHPKPPCRVITG
GAYGFERINVAGQRRDPNSLLNWMERMIRMRREVPEISWGDFHVLRASRDDVLALRYDWR
NNSVLCLHNFGAEACTVKFRSGCAEPGQNRLINLLSDDHSEESDDGRHAVVLEPYGYRWY
RVGGLDYLLRRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgatctctggtacaagaacgccattgtctattgcctttcggtaggcagcttc
atggacgcgaacggcgacggcgtgggcgatttcaagggcctgctgcgccgcctcgactat
ctgcaagggctcggcgtgacgacgatctggctgatgccgttccagccctcgccgggccgc
gacaatggctacgacatctccgactattacaacgtcgatccgaaatacggcacgctcggc
gacttctccgaattcacgcatgcgtgccgcgagcgcggcctgcgcgtgatgatcgacctc
gtggtcaatcacacgtccgatcagcacccctggttcagggaagcacgcagcgatcctgac
tcgccgtatcgcgactggtatgtgtggtccggcaggcagccgccgaatgcgaaagacggc
gtggtgtttcccggcgtgcagaagtcgacatggacgttcgacaaggaggcgaagcgctgg
tatttccatcgcttctacgaattccagcccgatctgaacaccgcgaatccgtatgtgcaa
gccgaactgctgaagatcatgggcttctggatccagctcggcgtgtcgggattccgcatg
gacgccgtgcccttcgtgatcgcgaccaaaggcccgcaggtgcgcaaacccgtcgagcaa
tacgacatgctgcgcgcgtttcgcgagtttctgcagtggcggcagggcgacgcgatcatc
ctcgccgaggcgaacgtgctgccgaatacggacctcgaatatttcggcgacgaaggcgag
cgtctgcagatgatgttcaatttccagctgaaccagaacacgttctacacgctcgcaacc
ggcgacaccgcgccgttgaagaaggcgctgacggccacgcgcccgcgtccggcgaccgca
caatggggcgtgtttctgcgcaatcacgacgagctcgacctcggccgcctgacgcccgaa
cagcgcgcagccgtgttcgccgcgttcgcacccgatccggacatgcagctctacgagcgc
ggcatccgccgccggctcgcgcccatgctcgcgggcgaccggcgccgtctggagctggcc
tacagcctgatgctgaccttgcccggcacgccggtgttccgttacggcgatgaaatcggc
atgggcgacgacctgcgcctgcccgagcgcgaatgcgcgcgcacgccgatgcaatggtcc
gccgaaccgcagggcggcttcaccaagcacccgaagccgccgtgccgcgtgataacgggc
ggcgcttatggtttcgagcgcatcaatgtggcggggcagcggcgcgatccgaattccttg
ctgaactggatggagcggatgatccgcatgcgccgcgaggtgccggaaatcagctggggc
gattttcacgtgctgcgcgcctcgcgcgacgacgtgctcgcgcttcgttatgactggcgc
aacaactcggtgctctgcctgcataacttcggcgccgaggcgtgcacggtgaaattccgc
tcgggctgcgcggagccgggccagaaccggctcatcaacctgctctcggacgatcacagc
gaggagagcgacgacggccgccatgcagtcgtgctcgagccttacggctaccgctggtat
cgggtgggcgggctcgattatctgctcagacgcagcgagatctag

DBGET integrated database retrieval system