KEGG   Burkholderia sp. CCGE1001: BC1001_3716Help
Entry
BC1001_3716       CDS       T01424                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1001_3716
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BC1001_3716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO Glutaredoxin K_oxygenase Thi4 FAD_binding_3 FMO-like FAD_oxidored NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADX57128
UniProt: E8YQR3
LinkDB All DBs
Position
2:complement(132674..134266)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVSVVERRDDNE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIVTGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKARTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLLEFGATLRADEVLQRKLRSLPNVTVITQAQTTEITGDGKKV
NGLVYKDLRSDEVKQIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEEAEAANEVEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcagttgaaaacgtacctcgaaaaggttagcaggcct
atcgagatcgtcgcgtcgctcgacgacagcgcaaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggagcgcgtgagcgtcgtggagcgtcgcgacgacaacgag
cgcaagccgtcgttttcgatcggcgagccgggcaaggacatcggcatccgcttcgcgggc
attccgatggggcatgaattcacgtcgctcgtgcttgcattgctgcaggtcggcggccat
ccagtcaaactcgacgacgccgtgatcgaacagatccgcagtctcgacggcgactatcaa
ttcgaaacgtatttctcgctctcgtgccagaactgcccggaagtggtgcaggcgctgaac
gtgatggcgttgatcaacccgcgcatccgccacgtggcgattgacggcgcgctgttccag
aacgaagtcgaagcacgccagatcatggcggtgccaaccatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcaaagctcgatacgaacgccgga
gcccgtgcggcgaaggaactggaaaagaagccggtgttcgacacgctgatcgtcggcggc
gggccggcgggcgcggcggcggcgatctattcggcacgcaagggcatcgtcacaggcgtg
gtcgcggaacgcttcggcggccaggtgctcgacacgctcgctatcgaaaacttcgtgtcc
gtcaccgaaaccgaagggccgaaattcgccaccgcgctcgaacagcacgtgaaaacgtac
gaagtcgacatcatggacgtgcagcgtgccgaagcgctgattccggggcgcatcaacgaa
gtgcgcctcgcaaacggcgcggtgctgaaggcccgaaccatcattctcgcgacgggtgcg
cgttggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcaatcacggcgtggcgtac
tgcccgcactgcgacggtccgctcttcaagggcaagcgcgtcgcggtgatcggcggcggc
aactcgggtgtggaggcggcaatcgacctcgcgggtatcgtgcgcgaagtcacgctgctc
gagttcggcgcgactttgcgagccgacgaagtgctgcaacgcaagctgcgcagcctgccc
aacgtgaccgttatcacgcaggcgcagaccaccgaaatcaccggcgacggcaagaaggtc
aatggcctcgtctacaaggacctgcgttccgatgaagtgaagcagatcgaactggaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgagtggctgaagggcacggtggaactg
tcgaagcacggcgagatcgtggtcgatgcacgcggcgcgacgtcggtcccgggcgtgttc
gcggccggcgacgtgaccaccgtgccgttcaagcagatcgtgattgcggtcggcgaaggc
gcgaaggcatcgcttagcgcattcgatcatctgattcgcaatagtgaggaagccgaagcg
gcgaacgaggtggaagccgaagcggcagtttga

DBGET integrated database retrieval system