KEGG   Burkholderia sp. CCGE1001: BC1001_3962Help
Entry
BC1001_3962       CDS       T01424                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00630  Glyoxylate and dicarboxylate metabolism
bug00710  Carbon fixation in photosynthetic organisms
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
bug01200  Carbon metabolism
Module
bug_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1001_3962
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1001_3962
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BC1001_3962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADX57373
UniProt: E8YSE2
LinkDB All DBs
Position
2:complement(409048..409476)
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEISLQIDYALSQGWACSVEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVKACRAARPDHYIKINAFDSVRGFETMRLSFIVNRPRDEPGFRLTREDGPGRV
QRYGLAGYASERPAGQRYGTER
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattacacagggcacgttttccttcctgcctgaattgaccgacgaggaaatcagt
ctgcagatcgactatgcgttgagccagggctgggcctgttccgtcgaattcaccgacgac
ccgcacccgcgcaatacctattgggaaatgtggggcctgccgatgttcgacctgcacgac
gcagcaggcgtgctgcaggaagtgaaagcctgccgcgcggctcggcccgatcactacatc
aagatcaatgcgttcgactcggtgcgcggcttcgagacgatgcgcctgtcgttcattgtg
aatcgcccacgcgacgagccgggcttccgcctcacacgcgaggatgggcctgggcgcgtg
caacgttatgggctggcgggttacgcgagcgagcggcccgccggccaacgctacggtacg
gagcgctga

DBGET integrated database retrieval system