KEGG   Burkholderia sp. CCGE1001: BC1001_5831Help
Entry
BC1001_5831       CDS       T01424                                 

Definition
(GenBank) Beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug01501  beta-Lactam resistance
bug02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bug00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC1001_5831
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BC1001_5831
Enzymes [BR:bug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BC1001_5831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Phage_Coat_Gp8
Motif
Other DBs
NCBI-ProteinID: ADX59196
UniProt: E8YWD4
LinkDB All DBs
Position
2:complement(2526072..2527256)
Genome map
AA seq 394 aa AA seqDB search
MKLKAMSLMASAVVALSVITPVSRAADDAANDATAAMKSLVDPAIEPLMERHHVPGMAVG
VIANGKTYVFDYGVASAETRQPVTQRTLFEIGSISKTFTATLAAYAQLNGQLNLTDDTQH
YLPSLRGSAFGKVSLLNLGTHTPGGLPLQVPDNIHDNAQLLQYFRAWKPAYAPGTYRTYA
NPGIGTLGLITAKSMGQDFASLIEQRMFPALGMTSSYIHVPAANISDYAQGYTKDGAPIR
MKGGVLADEAYGVRTTAADMVRFVQANMKLIGVDSQLQRAITATHTGYYKAGALTQDLIW
EQYPYPVTLSTLHEGNAPSMAVTPTPATAIEPPLPPQQNVWINKTGSTNGFGAYVAFIPG
KRVGVVLLANKNLPIEDRVSAAYRIMSALVAGGQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaaaagcgatgagcctgatggcgagtgccgtcgttgcgctcagtgtgatcacg
cccgtaagccgggcggcagacgacgccgcgaacgatgcgacagccgccatgaaatccttg
gtggacccggcaatagagccgctcatggaaagacaccacgtgcctggcatggcggtcggt
gtgatcgctaacggcaagacgtacgtgttcgactatggcgtcgcgtcggcggaaacgcgc
cagccggtcacgcagcgcacgctgttcgaaatcggctcgatcagcaagaccttcacggcg
acgctcgccgcttatgcccagctgaatggccagttgaatctcaccgatgacacgcaacac
tatctgccctcgttgcgaggcagtgcgttcggcaaggtgagcctgctgaacctcggcacg
cacacgcccggtggtcttccgctccaggtgccggacaacattcacgacaacgcccagctg
ctgcagtatttccgggcatggaagcctgcgtatgcgcccggcacttatcgcacgtatgcg
aatcccggcatcggcacactcggtttgattacggcgaagagcatgggccaggactttgca
tcgctgatcgagcagcgcatgtttccggcgctcggcatgacgagcagctacatccacgtt
cccgcggcaaacatatccgactacgcgcaaggctatacgaaagacggcgcgccgatccgc
atgaaaggcggcgttctcgccgacgaagcctatggcgtgagaaccaccgcggccgacatg
gtccgcttcgttcaggcgaacatgaaactgatcggcgtggacagccagcttcagcgcgcg
atcacggccacgcacacgggctactacaaggccggcgcgctgacgcaggacctcatctgg
gagcagtacccgtaccccgtgacattgagcaccttgcacgagggcaatgcaccctccatg
gccgtgacgccgacacctgccacggccatcgagccgccgctaccgccgcagcagaatgtg
tggatcaacaagactggctcgacgaacggcttcggcgcctatgtggcctttattcctggc
aaacgcgtgggcgtcgtactgcttgccaacaagaacttgccgattgaggaccgcgtgagc
gcagcgtaccgcatcatgtcggctctcgttgccggcgggcagtag

DBGET integrated database retrieval system