KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_186Help
Entry
BUAMB_186         CDS       T01830                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1b
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:buh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUAMB_186 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:buh01003]
    BUAMB_186 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buh01011]
    BUAMB_186 (mrcB)
Enzymes [BR:buh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BUAMB_186 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BUAMB_186 (mrcB)
Glycosyltransferases [BR:buh01003]
 Polysaccharide
  Bacterial polysaccharide
   BUAMB_186 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:buh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BUAMB_186 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AEO08009
UniProt: G2LP72
LinkDB All DBs
Position
205036..207264
Genome map
AA seq 742 aa AA seqDB search
MIIFYGCYLYIKINQVIHGKVWNFPNLIYSRIVNLEPGNIYSQNEILNFLKNTMYRKVDC
VMLPGEYSVKDNVIKFIRRSFDFPDIQEGEFYTQLLFKNNTLKKITNIKNGRNFSFFRLE
PQLIAMLTSPKKEKRIFLSRNKFPEILVKTLLSIEDKHFYEHDGIYISSIIRAFLANITA
GHVIQGGSTLTQQLIKNLFLTNQRSILRKINEIYMALILDFFYTKDRILELYLNEVYLGQ
DGDEQIRGFPLASIYYFGYPINELTLDQYALLVGMVKGASLYNPWNHPIAALKRRNLVLL
SLYNQAYITKNIYLHLSRRSLNVQPKGNITSPHPNFIQLVSEEFKKNIKNPINTFSGIRI
FTTLDSVSQNALEKAVKKEIPILKKQKKLKDLEIATIVIDKFTGEIQALIGSSIPKFSGY
NRVLNARRGIGSLSKPITYLTALSQPDKYHLNTWISDLPISIKLDNGEYWTPKNNNFHFS
GKVMLLDALIHSINIPTINLSMDMGFEKLVDNWVRLGIKRNQITSFPSISLGAINLTPIE
IAQVFQIIANNGYKKSLSSVKSVTFDDKKIFYHTVPQSKNIIATEASYLILYAMQQVVND
GTAKSLGKIFKEFSLAGKTGTTNNLIDSWFVGIDGKQVVITWIGRDNNKTTKLYGASGAM
QIYRRYLQYKLPTPLVLIPPKDINSFYIDKLGRLFCNKNDQHNRFLPVWNAQNKKNNYFN
KELECNATEKKKNIMSWLKNLL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
ttgattattttttatggatgctatttatatattaaaattaatcaagtaattcatggaaaa
gtatggaattttcctaatttaatatattcgcgtatagttaatttagaaccaggaaatata
tattctcaaaacgaaatattaaattttttaaaaaatacgatgtatagaaaagtagattgt
gttatgttaccaggagaatatagtgtaaaagataatgttataaaatttatacgacgttct
tttgattttcctgatattcaagaaggagaattttatacacaattgttatttaaaaataat
actttaaaaaaaattacaaatattaaaaatggtcgcaattttagtttttttcgtttagaa
ccacaattaattgcgatgttaacgtctcctaaaaaagaaaaacgtatttttttatctcgt
aataaatttccagaaatattagttaaaacacttttatcaattgaagataaacatttttat
gaacatgatggtatttatatatcttctataataagagcatttttagctaatataacagct
ggacatgttattcaaggtggaagtactttaactcagcaattaataaaaaatttattttta
acaaatcaacgttcaattttaagaaaaataaatgaaatatatatggcgttaattttagat
tttttttatacaaaagatcgtattttagaattatatttaaacgaagtgtatttaggtcaa
gatggtgatgagcaaattcgaggatttccattggcaagtatttattattttggatatcca
ataaatgaattaactttagatcaatatgcattattagtaggtatggtaaaaggagcttct
ttatataatccttggaatcatcctattgctgctttaaaaagaagaaatttagttttatta
tcattatataatcaagcatatattacaaaaaatatttatcttcatttgtctcgtagatct
ttaaatgttcaacctaaaggcaatattacttcacctcatcctaattttatacaattagta
tctgaagagtttaaaaaaaatataaaaaatcctattaatactttttcaggtataagaatt
tttactactcttgattctgtttcacaaaatgcattagaaaaagctgtaaaaaaagaaata
cctatattaaaaaaacaaaaaaaattaaaagatttagaaattgcaacaatagttatagat
aaatttactggtgaaattcaggctttaattggtagttcgattccaaaattttctggatat
aatcgtgttttaaatgctcgtcggggaattggttcgttatctaaaccaataacttatttg
actgctttatcacaacctgataaatatcatttaaatacttggatatctgatcttccaatt
tctattaaattagataatggtgaatattggacaccaaaaaataataattttcattttagt
ggaaaagtaatgttgttagatgctttaattcattcaattaatattcctactattaatctt
agtatggatatgggttttgaaaaattagttgataattgggtacgattaggtattaagaga
aatcaaattacttcttttccatctatttctttaggagcgattaatttaacgcctattgag
atagctcaggtatttcaaattattgcaaataatggctataaaaaatcattatcatcagtg
aaatcagtgacatttgatgataaaaaaatattttatcacactgtacctcaatcaaaaaat
attattgctactgaagcttcttatttaatattatatgctatgcaacaagtagttaatgat
ggaacagctaaatcattaggaaaaatttttaaagaattttctttagcaggaaaaactggt
actacgaataatttaattgatagttggtttgtaggaattgatggaaaacaagtagtaatt
acttggataggaagagataataataaaactactaaattatatggtgcttctggtgctatg
caaatttatcgaagatatctgcaatataaattgccaacaccattagtattaataccgcca
aaagatatcaatagtttttatatcgataaattaggaagattattttgcaataaaaatgat
caacataatcgatttttaccagtatggaatgcgcaaaataaaaaaaataattattttaat
aaagaattagaatgtaatgcaacagaaaagaaaaaaaatattatgtcttggttaaaaaac
ttattataa

DBGET integrated database retrieval system