KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_220Help
Entry
BUAMB_220         CDS       T01830                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00061  Fatty acid biosynthesis
buh00780  Biotin metabolism
buh01100  Metabolic pathways
buh01212  Fatty acid metabolism
Module
buh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:buh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BUAMB_220 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BUAMB_220 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:buh01004]
    BUAMB_220 (fabZ)
Enzymes [BR:buh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BUAMB_220 (fabZ)
Lipid biosynthesis proteins [BR:buh01004]
 Fatty acid synthase
  Component type
   BUAMB_220 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas Peptidase_A4
Motif
Other DBs
NCBI-ProteinID: AEO08042
UniProt: G2LPA5
LinkDB All DBs
Position
249717..250166
Genome map
AA seq 149 aa AA seqDB search
MNRKYDILNINKIFEILPHRYPFLLIDRIVHLENFKYLKAIKNCTINEPYFQGHFIKEPI
FPGVLIIEAMAQASSILIYKSTGQLNINKLYYFVGIDNARFKNIVIPGDQIIIEITFLQS
KRNMFIFKNKATVNKNIICKSKIIFAKKI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgaataggaaatatgatattttaaatattaataaaatttttgaaattttacctcatcgt
tatccttttttacttattgatcggattgtgcatttggaaaattttaaatacttaaaagca
attaaaaattgcactattaatgaaccatattttcaaggtcattttataaaagaaccaatt
ttccctggtgtgcttattattgaggcaatggctcaagcatcaagtatattaatatataaa
agtacaggtcaattaaatattaataaattatattattttgtcggaatagataatgcccgt
tttaaaaatatagttattcctggagatcaaataattatagaaataacttttttgcaatct
aaaaggaatatgtttatttttaaaaataaagctacagttaataaaaatataatttgtaaa
tctaaaattatttttgcaaaaaaaatatag

DBGET integrated database retrieval system