KEGG   Burkholderia sp. PAMC 28687: AX768_03455Help
Entry
AX768_03455       CDS       T05699                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00620  Pyruvate metabolism
bui00680  Methane metabolism
bui00710  Carbon fixation in photosynthetic organisms
bui01100  Metabolic pathways
bui01120  Microbial metabolism in diverse environments
bui01200  Carbon metabolism
Module
bui_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX768_03455
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AX768_03455
   00680 Methane metabolism
    AX768_03455
Enzymes [BR:bui01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AX768_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMM13306
UniProt: A0A126YET4
LinkDB All DBs
Position
1:complement(742930..745929)
Genome map
AA seq 999 aa AA seqDB search
MTSPGSARNARPRRNAVSKNEGSSVKAIAADVTVAAKASKARATAVKKPAVKEPAAKAAS
KPPKAASRTRDDKDLPLFEDIRYLGRLLGDVVREQEGDKVFDVVETIRQTAVKFRREEDS
EASQALDKRLKSLSPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSTPQAGTMA
YAIERLKASPDASSAQATLQKFFDAALIVPVLTAHPTEVSRKSILDAQHEVARLLAERDQ
DLTTRERAHNESMLRARVTSLWQTRMLREARLTVADEIENALSYYRATFLEEIPALYADI
EAALAEHGLPARLPPFLQMGSWIGGDRDGNPNVTAPTLVHAITRQATVIFEHYLEQVHKL
GAELSVSNLLAGASAELKKLADNSPDASPHRTDEPYRRALIGVYARLVASADERLGAGVV
AARSRHPAKPYASATEFAADLNVLIESLAAHHGEYLSAPRLSPLARAAEVFGFHLASIDL
RQSSDIHEAVIAELLAHAGVQDDYAALPEADKVALLLNELAQPRPLRLPYFDYSDLAKSE
LGVLEAARVTREKFGTRAVRNYIISHTETVSDLLEVMLLQKETGLLQGRLGHAKDPAHDG
LMVIPLFETIADLRNAPHIMGDFFALPGVNKLVELQGGEQEVMLGYSDSNKDGGFLTSNW
ELYRAELALVALFKQHKTTLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRTTEQGE
VIASKFGNPEIGRRNLELVVAATLEASLLPHENTPAQLPAFEATMQTLSDSAMAAYRALV
YETPGFKEYFFESTPISEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLL
TGWYGFGSAVTNFLDTASDAAERARRLAMLKKMHKTWPFFANLLSNMDMVLAKTDIAVAS
RYAQLVTDKKLRKHVFSRIVAEWERTSSVLSEITGHSERLANNPLLARSIKNRFPYLDPL
NHLQVELLKRHRAGDDNVRLGRGIHLTINGIAAGLRNTG
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcccggatcggcgcgcaatgcccgcccccgccgcaacgcggtatcgaagaat
gaaggttcgtccgtcaaggccattgcggccgatgtaacggttgccgccaaagcctccaag
gcgcgcgccaccgccgtcaagaagcctgctgtgaaagagcccgctgctaaggccgccagt
aagccgcccaaagccgcatcgcgtacacgcgacgacaaggaccttcccctcttcgaggac
atccgctatctcggccgcctgctcggcgacgtcgtgcgtgaacaggaaggcgacaaggtc
ttcgatgtcgtcgaaacgattcgtcagaccgcggtcaagtttcgtcgtgaggaagacagc
gaggcatcgcaggcgctggacaagcgcctgaaatcgctttcgcccgagcagactgtgagc
gtcgtgcgcgcgttcagctatttctcgcatctggcgaatatcgccgaggaccggcatcac
aaccggcgccgcaggattcatgcgctcgccggctcgacgccgcaggccggcacaatggct
tatgcaatcgagcggctgaaagcgagtcccgatgcttcatcggcgcaggcgacgctccag
aagttcttcgatgccgccctgatcgtgcccgtactgaccgcgcaccccacggaagtctcg
cgcaagagcattctggatgcacagcacgaagtcgcgcggctgctggccgaacgcgatcag
gacctgaccacacgcgaacgcgcgcacaacgagtcgatgctgcgcgcccgcgtcacgtcg
ctctggcaaacgcggatgttgcgcgaagcgcgcctgaccgtcgccgatgaaatcgaaaat
gcgctttcgtattatcgtgcaacgttcctcgaagaaattcctgcgctttacgctgatata
gaagccgcgctcgccgagcacggactgcccgcgcgcctgcccccgttcctgcaaatggga
agctggattggcggagatcgcgacggcaatccgaacgtcaccgcgcccacgctggttcac
gccatcacgcgccaggccacggtgattttcgaacactacctggagcaggtgcataagctc
ggcgcggaattatcggtgtcgaacttgctggccggcgcaagcgccgaactcaagaaactc
gccgataactccccggatgcgtcgccgcatcgtaccgatgagccttatcggcgcgcgctg
atcggcgtgtacgcaaggctcgtcgcgtccgccgacgaacgtctgggcgcgggcgtggtc
gcagcgcgcagccgtcatccggcgaagccgtatgcatcggcaactgagtttgccgccgat
ctgaacgtgctgatcgaatcgctcgccgcgcatcacggcgagtatctgtcggcgccgcgc
ttgtcgcctttggcgcgcgcggccgaagtgttcggcttccatctggcgagtatcgatttg
cgtcagagctcggacattcacgaagcggtgatcgcggagttgctggcgcacgcaggcgtg
caggacgattacgccgcgctgcccgaagccgataaagtcgcgttgctgctcaacgaactg
gcccagccgcggccgctgcgcctgccgtatttcgattactcggatctcgcgaagagcgaa
ctcggcgtgctcgaagcggcgcgcgtgacgcgtgagaaattcggtacgcgggccgtgcgc
aactacatcatttcgcacacggaaacggtcagcgatttgcttgaagtgatgttgctgcaa
aaggaaaccggcctgctgcaggggcgtctcggacacgcgaaagatcccgcgcacgatggc
ctcatggtgattccgctgttcgaaaccatcgccgacttgcgcaacgcgccgcacatcatg
ggcgactttttcgcgctgccgggcgtgaacaagctggtcgagctgcaaggcggcgagcag
gaagtcatgctcggttattccgacagcaacaaggacggcggttttcttacgtcgaactgg
gagttgtatcgcgcggaactggcgctggtcgcgttgttcaagcagcacaagacaaccttg
cgcctttttcacggccgtgggggcacggtcggtcgcggaggcggtccgacgtatcaggca
atcctgtcgcagccgccagggacggtagatggccagatacgcacgaccgagcaaggcgaa
gtgatcgcgagcaagtttggcaatcctgagatcgggcggcgcaatctcgagctcgtggtg
gcggcgacgctcgaagcttcgcttttgccacacgaaaatacgccggcgcagttgcccgcg
ttcgaagcaaccatgcagaccctgtcggattcggcgatggccgcgtatcgtgcgctggtt
tatgaaacgcctggattcaaggagtatttcttcgaatcgacgccgatttcggagattgcg
gagctgaacatcggcagccggccggcatcgcgaaaattgcaggatcctaagcaacgcaag
atcgaggatctgcgggcgattccgtggggcttttcgtggggccaatgccgtctgcttctg
acgggatggtatggcttcggcagcgcggtcacgaatttcctcgataccgcgtccgacgcc
gccgagcgcgcgaggcggctcgccatgctcaagaagatgcacaagacctggccgttcttc
gcgaacctgctctcgaacatggacatggtcctggcgaagacggacattgcggtggcttcg
cgttacgcgcaactcgtcaccgataaaaaactccgcaagcacgtgttcagccggatcgtg
gcggaatgggagcggacgtcgagcgtgttgtcggaaatcacggggcacagcgagcggctc
gcgaacaacccgctgctcgcgcggtcgatcaagaaccgcttcccgtatctggacccgctg
aatcacttgcaggtcgagttgctgaaacggcaccgcgcgggggatgacaacgtgcggcta
ggacgcgggattcacttgaccatcaacgggattgcggcggggttgcgtaatacgggttga

DBGET integrated database retrieval system