KEGG   Burkholderia sp. PAMC 28687: AX768_03885Help
Entry
AX768_03885       CDS       T05699                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00440  Phosphonate and phosphinate metabolism
bui01100  Metabolic pathways
bui01120  Microbial metabolism in diverse environments
bui01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AX768_03885
Enzymes [BR:bui01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AX768_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL Rsa3 NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: AMM13378
UniProt: A0A126YEE6
LinkDB All DBs
Position
1:830335..832041
Genome map
AA seq 568 aa AA seqDB search
MNAPYQLPAAYARSLRLREMLQSNELEFLMEAHNGLSARIVKEAGFKAIWGSGLTISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFLNGERQPLAEMDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDVFRQAGIST
VIWANHLLRGAASTMQAIAKEIHTSQTLVNVEDRVASVNEIFRLQDAEEYSTAEGVYLSS
ASASRNAVVLAASRGAGLEAVTADKPKVMLPIAGKPLLRRLVEAFKKEGINDITVVGGYR
ADAIDTSGVRLVVNEKHEQTGELASLACAAKSFTADTVISYGDLLFRSYILRDLVESDSD
FCVVVDSSQTPQAGVASTDFAFCSTADDRALFGQKVWLESVTSSAAPANVESKAPQGRWM
GLLNVRGAGRERLVATLEQLQRRDDFARLDMAALLNALIAAGERIEVQYVHGHWRGVNDL
DELRQAGDFAHGQAPYGSNGSSGAEAGA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgtatcaactgcccgcggcttatgcccgttcccttcgtctgcgcgaaatg
cttcaaagcaatgagctcgaattcctgatggaagcgcacaacggcttgtcggcgcgtatc
gtcaaggaagccggtttcaaggcgatctgggggtcgggcctgacgatctccgcgcagttc
ggcgtacgcgacaacaacgaagcaagctggacgcaagtggtcgacacgctcgagttcatg
gcggatgccagcgaccttcctatcctgctcgacggcgacactggttacggcaacttcaat
aatgtccgccggttggtgaagaagctggaacagcgcggtattgcaggcgtgtgtattgag
gacaagcagtttccaaagacgaactctttcctgaacggtgagcgccagccgctcgccgag
atggacgagttctgcggcaagatcaaggccggcaaggattcgcaaagcgatccgaatttc
tcgatcgtcgcgcgcgttgaagcgttgattgccggctggggcatggaagaggcgttaaag
cgcgccgaggcttatcgccaagccggtgcggacgccatcctgattcacagcaagctgtcg
aagcccgacgagatcctcacgttcgcacgtgaatgggccggccgcggtccgctcgtaatc
gtgccgaccaagtactacagcacgccaaccgatgtcttccgtcaggccggcatcagcacg
gtgatctgggcgaaccatttgctgcgcggtgcggcatcgaccatgcaggcgatcgcgaag
gaaatccacaccagccagacgctcgtgaacgtggaagaccgcgtggcgagcgtgaacgag
atcttccgtctgcaggatgccgaagagtattcgacggccgagggcgtgtacctgtcgtcg
gcgagcgcatcgcgtaacgcggttgttctggcggcaagccggggcgcaggcctcgaagcc
gtcaccgccgacaaacccaaggtgatgctgccgatcgcgggcaagccgctgctgcgccgc
ctggtcgaagcgttcaagaaggaaggcatcaacgacatcacggtggtgggcggttatcgc
gctgatgccatcgatacatcgggcgttcgccttgtagtgaacgaaaagcatgagcagacg
ggcgaactggcgtcgctcgcatgcgcagcgaaatcgttcacggccgacacggtcatctcg
tacggcgacctcttgttccgcagctacattcttcgcgatctggtggagtccgacagcgac
ttctgcgtggtcgtggattcgtcgcagacgccgcaagccggggttgcatcgacggacttt
gcgttctgctccaccgccgatgaccgcgcgctcttcggccagaaagtctggctcgaaagc
gtcacgagctcggccgctccggcaaacgtggaatcgaaagcgccgcaaggccgctggatg
ggcttgctcaacgtccgcggcgcgggccgcgagcgtctggtcgccacgctcgaacaactg
caacgacgcgatgacttcgccaggctcgacatggccgcgctgctcaacgcactgatcgcg
gcaggcgagcgcatcgaagtgcaatacgtgcatggccactggcgcggcgtgaacgacctc
gacgaactgcgtcaagccggtgacttcgctcacgggcaagcaccgtacggatcgaacgga
tcgtcgggcgcggaggcaggcgcgtga

DBGET integrated database retrieval system