KEGG   Burkholderia sp. PAMC 28687: AX768_06415Help
Entry
AX768_06415       CDS       T05699                                 

Definition
(GenBank) aminotransferase DegT
Organism
bui  Burkholderia sp. PAMC 28687
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMM15440
UniProt: A0A126YKH1
LinkDB All DBs
Position
1:complement(1383097..1384248)
Genome map
AA seq 383 aa AA seqDB search
MTSKTLPFLPFVRSEIDEETIQGVADVLRSGWITTGPQNTQFEADLSAYCGGRPVRTFNS
GTATMEIGLRIAGVGEGDEVVTTPMTWVSTSNVIIETGATPVFADIDPVTRNIDLDLLEK
AITPRTKAILPVYLSGLPVDMDRLYGIARDHKLRVIEDAAQAFGSTWRGKKIGSFGDMVS
FSFHANKNVTSIEGGALVLNNEEEAVLAQKYRLQGITRTGFDGMDCDLLGGKYNLTDVAA
RVGLGQLKHVGRFTEKRRELARAYFESFANGSAVRAGVQLPVQNFTDSNWHMFQIALPQE
RLSLTRSEFMGQMKERGIGTGVHYPALHLFTLYRARGFHEGMFPHAEKYGASTVTLPLFT
QMTHDDVTRVVQAVDEICAAHAI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccaaaacgctccctttcctgccgttcgtgcgctccgagatcgacgaagaaaca
atccagggcgtagccgacgtactgcgttccggctggatcacgaccggcccgcagaacacg
cagttcgaagctgatctgtctgcctattgcggcggccgcccggtgcgcacgttcaattcc
ggtacggcgaccatggaaatcggcttgcggattgcgggtgtaggcgaaggcgacgaagtc
gtcaccacgccgatgacctgggtctcgaccagcaatgtgatcattgaaacgggcgccacg
ccggtgtttgcggacatcgatccggtcacgcgcaatatcgacctggatctactggaaaaa
gccatcacgccgcgcaccaaggccatcctgccggtatatctctctggtttgcccgtggat
atggaccgcctctacggcatcgcccgcgaccataaattgcgcgtgatcgaagacgccgcg
caggcgttcggttcaacctggcgcggcaagaaaatcggctcgtttggcgacatggtttcg
ttcagttttcacgccaacaagaacgtgacgtccatagaaggcggcgcgctcgtcctgaat
aacgaagaggaagcggtgctggcccagaagtaccggctgcagggcatcacgcgcacgggc
ttcgacggcatggactgcgacctgctcggcggcaaatacaatctcaccgatgtcgccgct
cgcgtcggcctcgggcagttgaagcacgtcgggcgtttcacggaaaagcgccgcgagctc
gcgcgagcctatttcgagagtttcgcgaacggctcggccgtgcgcgcgggcgtgcaactg
ccggtgcagaacttcactgacagcaactggcacatgttccagattgcgttgccgcaggag
cgcctctccctcacgcgctcggaattcatggggcagatgaaggagcgcggcatcggcacg
ggcgtgcattacccggcgctgcatctgttcacgctgtaccgggcgcgcggattccatgaa
ggcatgttcccgcacgccgaaaagtatggcgcgtccacggttacgctgccccttttcacg
cagatgacccatgacgacgtgacgcgagtcgtgcaggccgtcgatgaaatctgcgcggcg
cacgccatataa

DBGET integrated database retrieval system