KEGG   Burkholderia sp. PAMC 28687: AX768_17080Help
Entry
AX768_17080       CDS       T05699                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00040  Pentose and glucuronate interconversions
bui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AX768_17080
Enzymes [BR:bui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     AX768_17080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AMM15960
UniProt: A0A126YM91
LinkDB All DBs
Position
2:375628..376662
Genome map
AA seq 344 aa AA seqDB search
MEALVLEEARRISLRPFTLPQVVGPRDVRIRINTVGICGSDIHYYQHGRIGPFVVNEPMV
LGHEAAGTVIQIGDEVTHLKVGDRVCMEPGVPDMESRASREGLYNLDPSVRFWATPPVHG
CLTPFVVHPAAFTFKLPDNVTFGEGAIVEPLAIGMQAATKAKIKPGDVAVILGAGTIGMM
CALAALAGGCSRAIVCDLVPEKLELIGGVQGVTAVNIRERKVKDVVAELTDGWGANIVFE
ASGNEKAFDGIVDLLCPGGCIVLVGMPQHPVPIDIVAGQIKEVRMESVFRYANMFPRAIQ
LIASGRLDVKPFISRSFAFADGIKAFEEAASGNPTDVKVQIVME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaagcactggttcttgaagaagcgcgtcgcatcagcttgcgtccgttcacattgccg
caggtcgtgggcccccgcgacgtgcgcatccgcatcaacacggttggcatttgtggcagc
gatatccactattatcagcatgggcgcatcgggccgtttgtcgtgaacgaaccgatggtg
ctcggtcacgaagccgcaggcacggtgatccagatcggtgacgaagtcacgcatctgaaa
gtgggggaccgcgtttgcatggaaccgggcgtgcccgatatggagtcacgtgcatcgcgc
gaaggtctgtacaacctcgatccaagcgtgcgtttctgggcaacgccgccggttcatgga
tgcctgacgccattcgtcgtgcacccggccgcgttcacgttcaagctgccggacaacgtg
acgttcggcgaaggcgcgatcgtcgagccgctggctatcggcatgcaggccgcgacaaag
gcgaagatcaagccaggggacgtggctgtcattctcggcgctggaaccatcggcatgatg
tgtgcgctggccgcgcttgcgggcggttgcagccgcgcgatcgtgtgtgatctcgtgccg
gaaaagctcgagttgatcggcggcgtgcaaggcgtgacggccgtgaacatccgggagcgc
aaggtgaaggacgttgtcgccgaactcaccgatggctggggcgcaaacatcgtcttcgaa
gcaagcggcaacgagaaggcgttcgatggcattgtcgacctgctgtgtccgggcggttgc
atcgtgctggtcggcatgccgcagcatccggtgcccatcgacattgtcgcaggacagatc
aaggaagtacggatggaatcggtcttccgttacgccaacatgttcccgcgcgcgatccag
ttgatcgcgtcgggccggctggatgtgaagccgttcatctcgcgctcgtttgcatttgcc
gacggcatcaaggccttcgaggaagcggcgagcggcaatccaaccgacgtcaaggttcag
atcgtgatggaatga

DBGET integrated database retrieval system