KEGG   Burkholderia sp. PAMC 28687: AX768_18725Help
Entry
AX768_18725       CDS       T05699                                 

Gene name
fabG
Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00061  Fatty acid biosynthesis
bui00780  Biotin metabolism
bui01100  Metabolic pathways
bui01130  Biosynthesis of antibiotics
bui01212  Fatty acid metabolism
Module
bui_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AX768_18725 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AX768_18725 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AX768_18725 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bui01004]
    AX768_18725 (fabG)
Enzymes [BR:bui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AX768_18725 (fabG)
Lipid biosynthesis proteins [BR:bui01004]
 Fatty acid synthase
  Component type
   AX768_18725 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NmrA Sacchrp_dh_NADP Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AMM16232
UniProt: A0A126YSU8
LinkDB All DBs
Position
2:complement(734389..735150)
Genome map
AA seq 253 aa AA seqDB search
MLLPEQNVLVTGGARGLGAAITEALAREGAGVVINYRRSEVQAKLLAERPGPRVVAIQAD
ITDKASVARLFDEAHAKTGRPVHAVVNNALANFSFDGDARPKIGDIEWARFQQQIDGALR
GAMNTIQAALPAMRAAGFGRIVNVGTNLFQNPVVPYHDYTAAKAALLALTRTASNDLGPD
GITVNMVSGGLLRTTDASSATPEAVFDMVAGFTPLRRVTTPAEFADAVLFFLSPWARAVT
GQNLVVDGGLVKG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctactgcctgaacagaacgtactcgtgaccggtggcgcacgcgggctcggtgcggcg
atcaccgaagcgctcgcgcgcgagggcgccggcgtcgtgatcaactatcgtcgtagcgaa
gttcaggcgaaactgctcgcggagcgtcccgggccgcgcgtggtggcaatccaggccgat
atcaccgacaaggcgtcggtcgcgcgtctcttcgacgaggctcacgcgaaaacgggccgc
ccggtgcatgccgtggtgaacaacgcgctcgcgaatttcagcttcgatggcgacgcgcgt
ccaaagatcggcgacattgaatgggcgcgctttcagcagcagatcgatggcgcgctcagg
ggcgcgatgaacacgattcaggccgcgttgcctgcgatgcgcgccgctggctttggccgt
atcgtcaatgtcgggaccaatctgttccagaatcctgttgtgccgtatcacgattacacg
gcggcaaaagcggcgttgctcgcgctgacgagaaccgcatcgaacgatctcggaccggat
ggcatcacggtgaacatggtgtctggcggcctgctgcgcaccaccgacgccagcagcgcg
acgcccgaagccgtgttcgacatggtcgcgggattcacgccgctgcgccgggtcacgacg
cctgccgagttcgccgacgcagtgctgttcttcctctcgccatgggcgcgcgcggtgacg
gggcagaacctggtggtcgatggagggttggtcaagggatga

DBGET integrated database retrieval system