KEGG   Burkholderia sp. PAMC 28687: AX768_23055Help
Entry
AX768_23055       CDS       T05699                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bui  Burkholderia sp. PAMC 28687
Pathway
bui00500  Starch and sucrose metabolism
bui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AX768_23055
Enzymes [BR:bui01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AX768_23055
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AX768_23055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AMM17137
UniProt: A0A126YR02
LinkDB All DBs
Position
3:complement(54237..57626)
Genome map
AA seq 1129 aa AA seqDB search
MKRNKNSTLSNDPLWYKDAIIYQIHIKSFFDANNDGIGDFPGLLAKLDYIAELGVDCIWL
LPFYPSPRRDDGYDIADYRNVHPDYGTLADVKRFIQEAHARGIRVVTELVINHTSDQHPW
FQRARLAKPGSNHRNYYVWSDTDKKYEDTRIIFIDSEPSNWTHDPVAGQYYWHRFFNHQP
DLNFDNPAVLKEVLSVMRFWLDMGIDGLRLDAVPYLVEREGTNNENLPETHAILKTIRAT
IDKEYPNRMLLAEANQWPEDVKEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPITDIMR
QTPDLAPTNQWAIFLRNHDELTLEMVTDSERDYLWNTYASDRRARLNLGIRRRLAPLMER
DRRRIELINSLLLSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADP
EQLVLPPVMGSLYGYDAINVESQSRDPHSLLNWTRKMLAVRRAKHAFGRGTIRFLRPNNR
KILAYIREIEGEPPILCVANLSRAPQAVELDLSEYAGSVPLEMTADSAFPPIGQLTYLLT
FPPYGFLWFQLCPGNQRPAWSQAPSEQLPEFVTMVIRAGQTGPTPENVRLLESEVLPSYL
SKRRWFASKDQTLKRVRLAALTTIPEAGFAFTEVEADVGDHTERYVLPLTIAWGTETTSP
LYMQLALARVRQSRNMGHITDAFAVPTFTYGVLRKLKERAVVPTVQKSEIRFIPTERLDA
LNFNFKPGEPLPEIRWLAAEQSNSSLVIGDQVVLKLVRRLVGGIHPEAEMSRYLTKLGYA
NTGPLFGEVVRVDPEGVPHTLCILQGFIDNQGDAWNYALDYLRRTVDELALAVDTEDHSM
DREKEMQGIEGYRTIAGIIGRRLGELHVALASPSDDPAFAPEMASKEDVRAWNDGTHTLL
VTALDILGAKIRDFSEHDRELAQSLLDRRDLLLAAVQKLVPESANALRIRIHGDFHLGQV
LMAQGDAFLIDFEGEPARPLEERRKKSSPLRDVAGLLRSLSYASAAAQPTTENAPAAAAD
RKRALFERLRAHGEEGFLAEYNAAVAASPQPVAGDEATLAALLDLFLIEKAAYEIRYEAA
NRPTWIGLPLRGLASLASRLLGDTGAPLAPGSRPADAAEKDISDGNENE
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcaacaagaattcgactctcagcaacgatccgctctggtacaaagacgcgatc
atctatcaaatccacatcaagtccttcttcgatgccaacaacgacggcatcggcgatttt
ccaggcctgctggccaagctcgattacatcgcggaactcggcgtcgattgcatctggctg
ctgccgttctatccatcgccacgacgcgacgacggttacgacatcgccgattatcgcaac
gtgcatcccgattacggcacgctcgccgacgtcaagcgcttcattcaggaagcgcacgca
cgcggcattcgcgtggtgacggaactggtcatcaaccatacctccgatcaacacccgtgg
ttccagcgcgcccggcttgcaaagcccggctcgaaccatcgcaattactacgtctggtcg
gataccgacaagaagtacgaagacacgcggatcatcttcattgattccgagccgtccaac
tggacgcacgatcctgttgcgggacagtactactggcaccggttcttcaatcaccagccc
gacctgaacttcgacaaccctgccgtgctgaaggaagtgctgtccgtcatgcgcttctgg
ctggatatgggtatcgacggtctgcggctggatgccgtgccgtatctcgtggaacgcgaa
ggtacgaacaacgaaaacctgcccgagacgcacgcaatcttgaagacgatccgcgcgacc
atcgacaaggaatatccgaaccgcatgttgctggccgaggcgaatcaatggccggaagac
gtgaaggagtatttcggcgatgaagacgaatgccacatggccttccacttcccgctgatg
ccgcgcatctacatgtcgattgcgagcgaggaccgcttcccgatcaccgacatcatgcgt
cagacgccggatctcgcgccgaccaaccaatgggcgattttcctgcgcaatcacgatgaa
ctcacgctcgaaatggtgaccgattcggagcgcgattatttgtggaacacgtatgcaagc
gatcgccgtgcgcgcctgaacctcggcattcgccgtcgtcttgcgccgctgatggaacgg
gatcgccgccgtatcgagctgatcaattcgctgctgctgtccatgcccggtacgcctgtg
atctattacggcgacgaactcggcatgggcgacaacatccacctgggcgaccgtgacggc
gtgcgtacgccgatgcagtggtcatcggacaggaacggcgggttttcgcgcgctgatccg
gaacagctcgtgttgccgccggtgatgggttcgctctacggttacgacgcgatcaacgtg
gaatcgcaaagccgcgatccgcactcgctgctcaactggacgcgcaagatgctcgccgtg
cgtcgcgcgaaacatgcattcggccgtggcacgatccgcttcctgcgcccgaacaaccgc
aagatcctggcgtatatccgcgagatcgaaggcgaaccgccgatcttgtgtgtcgcgaat
ctttcgcgtgcgccgcaagccgtcgaactcgacctgtccgaatacgccggttccgtgccg
ctggaaatgaccgccgattccgcgtttccgcccatcggccagttgacgtatctgctgacg
ttcccgccgtatggcttcctgtggttccagctttgcccgggcaatcagcgtccggcatgg
agccaggcgccgtcggagcaattgcccgagttcgtgaccatggtgattcgcgccgggcag
accggcccgacgccggagaatgtgcgcctgctcgaatccgaagtactgccgtcttacttg
agcaagcggcgctggtttgcatcgaaggaccagacgctgaagcgcgtgcgccttgccgcg
ttgaccacgatccccgaagccgggttcgcgttcaccgaagtggaagccgatgttggcgat
cacaccgaacggtatgtgttgccgctgacgattgcgtggggcacggaaaccacgtcgccg
ctctatatgcaattggcgctggctcgtgtgcgccagagccgcaacatgggccatatcacc
gacgccttcgcggtcccgacatttacgtatggcgtgctgcgcaagctcaaggaacgcgct
gttgtaccgaccgtgcaaaagagcgagatccgcttcatcccgaccgaacgtctggatgcg
ttgaacttcaatttcaagccgggcgaaccgctgcccgagatccgttggcttgccgccgag
cagagcaacagctcgctcgtgattggcgaccaggtcgtgctgaagctcgtccggcgcctc
gttggcggcattcatccggaagccgagatgagccgctacctgacgaagctcggctatgcg
aacaccggtccgctgttcggcgaggtcgtgcgcgtcgatccggaaggcgtgccgcacacg
ctctgcatcttgcaggggttcatcgacaaccagggcgatgcctggaactatgcgctcgat
tatctgcgccgcaccgtcgatgaactcgcgctggcagtggacaccgaagaccattcgatg
gatcgcgagaaggagatgcaaggcatcgagggataccggacgattgcggggatcatcggg
cgtcgtctgggcgaactgcacgtcgcgctcgcctcgccgtccgacgatccggcgttcgcg
cccgagatggcatcgaaggaagatgtgcgcgcatggaacgacggcacgcatacgctgctc
gtcaccgcgctcgatatcctcggcgccaagatccgcgacttcagcgagcatgatcgcgaa
ctcgcgcagagcctgctcgatcgccgcgatctgttgctcgcagccgtgcagaaactcgtg
ccggaaagcgccaacgcgctgcgtatccggattcacggcgacttccacctgggccaggtc
ttgatggcgcaaggcgatgctttcctgatcgacttcgaaggcgaaccggcgcggccgctg
gaggaacgccgcaaaaagtcgagcccgttgcgtgacgtggccggcttattgcgttccttg
tcctacgccagcgccgctgcgcagccgacgaccgaaaacgcaccggcagccgccgccgat
cgcaaacgtgcactgttcgagcgcctgcgcgctcatggcgaagaaggtttccttgctgaa
tacaacgcggcggttgcagcttccccgcagcccgtcgccggcgatgaagccaccctggcc
gccttgctcgatctcttcctgatcgaaaaggccgcctacgaaatccgctatgaagcggca
aaccgtccgacctggatcggcttgccgttgcgtggcctcgcgtcgcttgcgagccgcctg
cttggcgacaccggcgcaccgctcgcgcccggctcgcgtcccgcggacgccgcagaaaag
gacatctccgatggaaacgaaaatgaataa

DBGET integrated database retrieval system