KEGG   Burkholderia sp. PAMC 28687: AX768_24800Help
Entry
AX768_24800       CDS       T05699                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bui  Burkholderia sp. PAMC 28687
Brite
KEGG Orthology (KO) [BR:bui00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AX768_24800
Enzymes [BR:bui01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AX768_24800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored FAD_binding_2 FAD_binding_3 HI0933_like K_oxygenase DAO Thi4 FMO-like AlaDh_PNT_C Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMM17435
LinkDB All DBs
Position
3:complement(428987..430576)
Genome map
AA seq 529 aa AA seqDB search
MLEANLKTQLKAYLEKVSRPIEIVASLDDSPKSVELKDLLQEIATLSDRIAVIETRDDDQ
RKPSFSIGEPGKPTGIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDAVIEQIRSLDGDYQ
FETYISLSCQNCPEVVQALNVMALINPRIRQVTIDGALFQDEVEKRQIMAVPTVYMNGEV
FGQGRTGVKEILAKLDSNAGARAAKEIEGKGTFDVLIVGGGPAGAAAAIYAARKGISTGV
AAERFGGQVLDTLAIENFVSVKETEGPQFATALEQHVKSYEVDIMDVQRAEALVPGTIHE
VRLANGAVLKAKTIVLATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSAVTLIEFGAELRADAVLQRKLRSMKNVTIITQAQTTEVTGDGKKV
NGLSYKDLRSGEAKHIELEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDAKGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRNSVSEEVEVGAEEAVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagccaacctcaagactcagttgaaagcgtatctggaaaaggtcagccggccg
atcgagatcgtcgcttccctcgatgactccccgaagtcggtcgaattgaaagacctgctc
caggaaatcgccacgctgtcggaccgcattgcggtgatcgaaacgcgtgacgacgaccag
cgcaagccgtcgttttccattggcgaaccgggcaagcctacgggcatccgcttcgcaggc
attccgatgggccatgaattcacctcgctcgtgctggcgctgctgcaaaccggcggccac
ccggtcaagctcgacgacgccgtgatcgaacagatccgctcgctcgacggcgactatcag
tttgaaacgtatatctcgttgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgctcatcaacccgcgcattcgccaggtcaccatcgacggcgcgttgttccag
gacgaagtcgagaagcgccagatcatggccgtgccgaccgtttacatgaacggcgaagtg
ttcggccagggccgcaccggcgtgaaggaaatcctcgccaagctcgacagcaacgctggc
gcgcgggctgcaaaggaaatcgaaggtaaaggcacgttcgacgtgctgatcgtcggcggc
ggacctgccggtgcggctgccgcaatctacgcggcgcgcaagggcatctcgacgggcgtt
gcggccgaacgcttcggcggccaggtgctggatacgctcgccatcgaaaattttgtctcg
gtgaaagagacagaaggaccgcagttcgcgacggcgctggaacagcacgtcaagagctac
gaagtggacatcatggacgtgcagcgtgccgaagcgctcgtgccgggaacgatccacgaa
gtgcgcctcgccaacggagcagtgctgaaagcgaagacgatcgtgctggcaaccggtgcc
cggtggcgcgaaatcaacgtgccgggtgagaaggaatatcgcaatcacggcgtggcctat
tgcccgcattgcgacggtcctctcttcaagggcaagcgcgtagcggtgatcggcggcggt
aattccggcgtggaagcggcgatcgacctggcgggtattgtcagcgccgtgacgctgatc
gaattcggcgcagagttgcgtgccgatgccgtcttgcagcgcaagcttcgcagcatgaag
aacgtgacgatcatcacgcaagcgcagaccacggaagtcaccggcgacggcaagaaggtc
aacggtctttcgtacaaggatctgcgttcgggtgaagcgaagcacatcgagctggaaggt
gtgttcgtgcagatcggcctcgtgccgaataccgaatggctcaagggcacggtcgagctg
tcgcgtcacggtgaaatcgtggtcgatgcgaagggcgcaacgtcggtgccgggcgtgttt
gctgccggcgacgtcaccaccgtgccgtacaagcagatcgtgattgcggtgggcgaaggc
gcaaaggcgtcgctgagcgcattcgattatttgatccgcaattcggtatcggaagaagtt
gaagttggcgcggaagaagcagtcgcttga

DBGET integrated database retrieval system