KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0025Help
Entry
BurJV3_0025       CDS       T01596                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:buj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BurJV3_0025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:buj03400]
    BurJV3_0025
Enzymes [BR:buj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BurJV3_0025
DNA repair and recombination proteins [BR:buj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BurJV3_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C SPOR RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEM49361
UniProt: G0K266
LinkDB All DBs
Position
27055..29529
Genome map
AA seq 824 aa AA seqDB search
MSLHQYRRKRRLGGGAGQTPEPDETPARTDPKRRPIFVIQLHHASSRHYDFRLEMDGVLK
SWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGAGHVDVFDHGTWACEGDPL
QALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKRSDEEARDAEADDLLGAPAVM
KRTAGKTGRAVPAARTSTRKADARWHARALKLDGARDAPYPHGFKPQLTDHRDSAPDGAH
WLHEIKWDGYRLLADLHDGEVKLRSRNGLDWTDDFPEVVQAVRALPVRDARLDGELVVLD
PEGRSDFAALQRVIDGSSKQPLRYIVFDLPGVANADVSRAPLLERKALLKDLIGPTPGIL
AFSEHVIDHGPQVFDASGEAGFEGIVSKQVDAPYVNARARSWVKVKHEDTDEFVIVGYTA
PRGSRVGFGSLLLATPDKEGLRYVGRVGTGFDDENLRALFKALQPLAVKTPVLQLPAHVP
FRAASVRWLKPVRVAEVAFRGWGKEGLLRQASFKRLRSDKQKEDLGMSTATADAEVGGEV
QITHPERVVFPRQRLSKGDVADYYRRMARWILPEIAGRPLSLLRCPDGVGKACFFQKHHG
PGLGDAVHAVPLQQKSGREDYVYIDDARGLLQLVQMNTLELHPWGATVADPEHPDRLVFD
LDPGDGVSWAQVKAGARDVRDRLQQVGLESFVRLSGGKGVHVVVPLQPKAGWDEAKAFCE
AFAQAMAQEQPDRYVATMSKAKRRGVIFIDWLRNTRGATSVCSWSLRARDSAGVAVPLRW
EELARVSAADAFPMGKALARAKRLKGDPWQGIARLKQTLPSLKQ
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcaccagtacaggcgcaagcgccgacttggtggtggcgccgggcagacgccg
gaacctgacgaaacgcctgcacgcactgatcccaagcggcggcccatcttcgtcatccag
ctgcaccatgccagttcgcgccactacgacttccgccttgaaatggacggtgtactgaag
agctgggcggtgccgaagggaccttcgctgcgtgtcggtgagaagcgactggccgtggaa
gtggaagaccatccgctgtcctacgccggtttcgaaggagacattcctgaaggccactat
ggtgctggccacgtggatgtgttcgatcacggcacctgggcctgtgagggcgatccattg
caggcgctggccgccggaaagatcgatttcgtgctgcacgggcagcgcctggccggtggc
tggaagctggtgcgcacggcaatgaaggggcgtcaggtgcagtggctgctgatcaagcgc
agtgacgaggaagcgcgcgacgccgaagcagatgatctgctgggcgcgcccgcagtgatg
aagcgcactgcggggaagacagggcgtgctgtgccggccgcacgcacgtctacccgcaag
gccgatgcacgctggcatgcgcgcgcgctgaaactggacggcgcacgtgacgcgccctac
ccgcatgggttcaaaccgcaattgaccgatcatcgagacagtgcgccggacggcgcgcac
tggctgcacgagatcaagtgggacggctatcgcctgttggccgatctgcatgacggcgag
gtaaagctgcgctcccgcaatggcctggattggaccgacgatttccccgaggtggtacag
gccgtgcgggcgctgccggtgcgtgatgcgcgcctggacggtgagctggtggtgctggac
ccggaagggcgcagcgatttcgcagcgctgcagcgcgtgatcgatggaagctcgaagcaa
ccgctgcgctacatcgtgttcgatcttccgggtgtggccaacgcggacgtcagtcgtgcg
ccattgctggaacgcaaagcgctgctgaaggatctcatcggacccacgcccggcatcctg
gccttcagcgaacatgtgatcgaccacggcccgcaggtattcgatgccagtggcgaggcg
ggattcgaaggcatcgtcagcaagcaggtggacgcgccgtacgtgaacgctcgcgcccgc
agctgggtgaaggtgaagcacgaagacaccgacgagttcgtgattgtcggctacacggcc
cccaggggctcgcgggtgggtttcggatcattgttgctggcaacaccggacaaggagggc
ctgcgctatgttggccgcgttggtaccggcttcgatgacgagaacctgcgcgcgctgttc
aaggcattgcagccactggcagtaaagacccccgtgctgcagcttccggcgcatgtgccg
ttccgcgctgccagcgtgcgctggctgaagccggtgagggtggcggaagtggccttccgt
ggctggggcaaggaaggcctgctgcgccaggcaagtttcaagcggctgcgcagcgacaag
cagaaggaggacctgggaatgagcacagcaacggcagatgctgaagtcggaggcgaggtc
cagatcactcatccggagcgggtggtgtttcccaggcagagactgagcaaaggcgacgtg
gccgactattaccggcgcatggcgcgctggatcctgcccgagatcgccggacgtccgctg
tcactgctgcgctgccccgatggggtgggcaaggcctgtttcttccagaagcatcatggc
cccggcctgggtgacgcggtgcatgcagtgcccctgcagcagaagagtggccgcgaggat
tacgtctacatcgatgatgcgcggggcctgctgcagctggtgcagatgaacacgctggag
ctgcatccatggggtgcgaccgtggccgacccggagcatccggatcgactggtgttcgat
ctcgaccctggcgacggcgtcagctgggcacaggtgaaagccggtgcacgcgatgtgcgt
gaccgcctgcagcaggtgggtctggagagcttcgtgcgactgtctggcggcaagggggtg
cacgtggtggtgccactgcagcccaaggctggctgggacgaggcgaaggcattctgcgaa
gcctttgcgcaggcaatggcacaggagcaacctgatcgctatgtggcgacgatgagcaag
gccaagcgccgtggcgtcatcttcatcgactggttgcgcaacacccggggggccaccagc
gtgtgctcgtggtcgctgcgcgcgcgcgattccgccggtgtggcagtgccactgcgctgg
gaagaactggcgcgggtgagcgcggccgacgcgtttccgatgggcaaggcgctggcgagg
gcgaagcggctgaagggggacccatggcagggcatcgcacggttgaagcagacgctgccg
tcgctgaagcagtag

DBGET integrated database retrieval system