KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0027Help
Entry
BurJV3_0027       CDS       T01596                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00010  Glycolysis / Gluconeogenesis
buj00071  Fatty acid degradation
buj00350  Tyrosine metabolism
buj00625  Chloroalkane and chloroalkene degradation
buj00626  Naphthalene degradation
buj01100  Metabolic pathways
buj01110  Biosynthesis of secondary metabolites
buj01120  Microbial metabolism in diverse environments
buj01130  Biosynthesis of antibiotics
buj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:buj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BurJV3_0027
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BurJV3_0027
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BurJV3_0027
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BurJV3_0027
   00626 Naphthalene degradation
    BurJV3_0027
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BurJV3_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEM49363
UniProt: G0K268
LinkDB All DBs
Position
complement(30121..31149)
Genome map
AA seq 342 aa AA seqDB search
MNSTMKAAVVREFGKPLVIEEVSVPRPGAGEVLVKIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGGGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCETQRNTGYSV
NGGFAEYALADANYVGLLPKDVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGGL
GHMAVQYARAMGLNVAAVDVDDNKLALARQLGAQITVNARTTDPAAFLRKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLNGITVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDRLENINDVFARMHAGTIEGRVVLDFAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaccatgaaggccgctgtcgtgcgtgagttcggcaagccactggtgatcgag
gaagtctcggtaccacgcccgggggcgggcgaggtgctggtcaagatcgaggcctgtggc
gtctgccacaccgacctgcacgccgccgagggcgactggccggtgaaaccgaacccgccg
ttcatccccggccacgagggcgtggggcacgtcgtggccgtgggaggcggggtagggcac
gtcaaggaaggcgacagggtcggcatcccctggttgtactcggcgtgtggccattgcgaa
cactgcctgggtggctgggaaacgctgtgcgagacacagcgcaacaccggttactcggtc
aacggcggcttcgccgagtacgcactggccgatgccaactatgttggcctgcttccgaag
gacgtaggcttcgtcgagatcgcgccggtgctgtgcgccggcgtgaccgtctacaagggc
ctgaaggtcaccgacaccaaacccggtgactgggtggcgatttccggcatcggtggcctg
ggccacatggcggtgcagtacgcccgcgcgatggggctgaacgtggctgcagtggatgtg
gacgacaacaagctggcattggcccggcagcttggcgcgcagatcaccgtgaacgcgcgt
accaccgatccggccgccttcctcaggaaggaaatcggcggcgcgcatggtgcgctggtc
accgcggtgtcgccgaaggcattcgagcaggcgctgggcatggtccgccgtggcggcacc
gtctcgctcaacggactgccgcccggtaatttcccgctggacatcttcggcatggtgctc
aacggcatcaccgtgcgtggctcgatcgtcggcacccgactggacctgcaggagtcgctg
cagttcgctgccgaaggcaaggtcgcggccacggtcagcaccgaccgcctggaaaacatc
aacgacgtgttcgcgcgcatgcatgcgggcaccatcgaaggccgcgtggtgctcgacttc
gccgcctga

DBGET integrated database retrieval system