KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0115Help
Entry
BurJV3_0115       CDS       T01596                                 

Definition
(GenBank) copper/zinc-binding superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Brite
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BurJV3_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Glyco_hydro_81 CHRD LPAM_2
Motif
Other DBs
NCBI-ProteinID: AEM49451
UniProt: G0K3P1
LinkDB All DBs
Position
133862..134488
Genome map
AA seq 208 aa AA seqDB search
MRLIHTSLFAAIAALGLAACGQQPAAPQTETPPAAPAEGATSEPAAAPAPAAAPAADASA
TAELAPTQGNEAKGSVTFKVVDGKVHVTGQITGLKPGSEHGFHIHEKGDCSAPDGMSAGG
HFNPGHQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVSSNVNIGKGDDFDIIGRGLIV
HADADDYKTQPTGNAGARLACAVIQKAP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatccacacttcactgtttgcggccatcgccgcgctgggcctggcggcctgc
ggccagcagccggccgctccgcagactgaaaccccgccggccgccccggccgagggcgcc
acctccgaaccggccgcagccccggcacctgctgccgccccggcggccgatgcctcggcc
accgccgagctggcaccgacccagggcaacgaggccaagggcagcgtcaccttcaaggtg
gtcgacggcaaggtccacgtgaccggccagatcaccggcctgaagccgggcagcgagcac
ggcttccacatccacgaaaagggcgactgcagcgcaccggacggcatgagcgccggcggc
cacttcaacccgggccaccaggatcacggcaacgttgccaccgatccgcaccacggcggc
gacatgcccaacatcaaggccgacgacaagggcgtggccaccatcgacggcccggtgtcg
agcaacgtcaacatcggcaagggtgatgacttcgacatcattggccgcggcctgatcgtc
cacgccgatgcggacgactacaagacccagccgaccggcaacgccggtgcgcgcctggcc
tgcgcggtgatccagaaggcgccgtaa

DBGET integrated database retrieval system