KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0165Help
Entry
BurJV3_0165       CDS       T01596                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00473  D-Alanine metabolism
buj00550  Peptidoglycan biosynthesis
buj01100  Metabolic pathways
buj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:buj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BurJV3_0165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BurJV3_0165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BurJV3_0165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buj01011]
    BurJV3_0165
Enzymes [BR:buj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BurJV3_0165
Peptidoglycan biosynthesis and degradation proteins [BR:buj01011]
 Precursor biosynthesis
  Amino acid ligase
   BurJV3_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: AEM49501
LinkDB All DBs
Position
complement(188152..189267)
Genome map
AA seq 371 aa AA seqDB search
MARTRVGIIFGGKSSEHEVSLQSAKNILDALDHERFEPVLVGIDKQGQWHLSQPDTFLIN
ADDPSRIALHRSGQSLAVRPGAEQAQLQPSDAASALGQIDVVLPIVHGPLGEDGALQGLL
RMANLPFVGSPVLGSAVAMDKDVTKRLLRDAGLKVAPWLCIRRHQAAAVDAEAVIAQLGL
PLFVKPANQGSSVGVSKVKDAAGFTAALELALRYDHKVLVESAVVGREIECAVLGNEQPQ
ASLCGEVVVHDEFYAYDTKYINEDGAEVVVPADIDAATQARIQQVALQAYQALECAGMAR
VDVFLTAGGDIIINEVNTLPGFTRISMYPKLWGASGVDYTTLITRLIELAQERHAADRGL
HSAVQERSLSL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcacggacccgggtcggcatcatcttcgggggcaagtcctccgagcacgaggtttca
ctgcagtcggcgaagaacatcctcgatgcgcttgatcacgagcgcttcgagccggtgctg
gtcggcatcgacaagcagggccagtggcatctgagccagccggacaccttcctgatcaat
gccgatgatccgtcgcgcatcgcgctgcatcgctcgggtcagtcgctggcggtacgcccg
ggtgccgagcaggcgcagctgcagccctccgacgccgccagtgcgctgggccagatcgac
gtcgtgctgccgatcgtgcatgggccgctgggcgaggacggtgcgctgcagggcctgctg
cgcatggccaacctgcccttcgtcggttcgccggtgctgggttcggcggtggcgatggac
aaggacgtgaccaagcgcctgctacgcgacgccggactgaaggttgcaccgtggctgtgc
atccgtcgccatcaggcggcggcggtcgatgccgaggcggtgatcgcgcagctcggcctg
ccgctgttcgtgaaaccagccaaccagggttcgtcggtgggcgtgagcaaggtcaaggat
gcggcgggtttcaccgcggcactggaactggcactgcgctatgaccacaaggtgctggtg
gaatcggcggtggtcggccgtgagatcgagtgcgcggtgctggggaacgaacagccgcag
gccagcctgtgcggcgaagtcgtggtgcacgacgagttctacgcctacgacaccaagtac
atcaacgaggatggcgccgaggtggtggtacccgcggatatcgatgccgcaacccaggcg
cgcatccagcaggtcgcactgcaggcctaccaggcgctggagtgtgccggcatggcgcgc
gtggacgtgttcctcaccgcgggcggcgacatcatcatcaacgaggtcaacacgctgccc
ggcttcacccgcatcagcatgtacccgaagctgtggggtgccagcggcgtggactacacc
acgctgatcacgcgcctgatcgagctggcgcaggaacgccatgcagccgatcgtggattg
cacagcgccgtgcaggagcgctcgctgtctctgtag

DBGET integrated database retrieval system