KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0700Help
Entry
BurJV3_0700       CDS       T01596                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buj  Stenotrophomonas maltophilia JV3
Brite
KEGG Orthology (KO) [BR:buj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BurJV3_0700
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BurJV3_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 NAD_binding_8 Thioredoxin_4 FMO-like dsrm
Motif
Other DBs
NCBI-ProteinID: AEM50034
LinkDB All DBs
Position
complement(796070..797662)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLESLSDKITLQVLRDGQG
RVPSFDLGTPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGDYK
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQDEVEQREIMSVPTVYLNGEV
FDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMNLQRASALVPAGEDG
LVQVQLENGAVLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLRSLANVTVLTSAQTTEVLGDG
SRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDVVALSPRGEIVIDDRGQTNLP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSNSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctgcagtcgcagctgaagacctatctggagcgcgtgacccgcccg
atccagatcaccgcgcacgccgacgacggcgccaagtcgcaggaaatgctggaactgctg
cagaccctggaaagcctgtcggacaagatcacgctgcaggtcctgcgcgatggccagggc
cgcgtgccgtccttcgacctgggcaccccgggccaggacatccacctgaccttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcggccac
ccgtccaaggccaccgccgagctgatcgagcaggtgcagaacctggaaggtgactacaag
ttcgaaacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcagtgctcaacccgcgcatccagcacgtggccatcgacggcgccctgttccag
gacgaagtcgagcagcgcgagatcatgtcggtgccgaccgtgtacctcaacggtgaagtg
ttcgaccagggccgcatgaccctggagcagatcgtggccaagctggacaccaatgccagc
aagcgcgatgccgagaagatcgccgccaaggacgctttcgacgtgctggtggtcggcggt
ggcccggctggcgcggcagcggcgatctatgccgcacgcaagggcatccgcaccggcatc
gccgccgagcgtttcggtggccaggtgctggacacgatggcgatcgagaacttcatctcg
gtgaaggagaccgaaggcccgaagctggccacggcgctggagcagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccagtgcgctggtgccggccggtgaagacggc
ctggtgcaggtgcagctggagaacggcgcggtgctgaagtcgcgctcggtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgccgggcgaagaccagtaccgcaacaagggc
gtggcctactgcccgcattgcgatggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcagccatcgacctggccggcatcgtgtcgcatgta
accctgctggagttcgattccagcctgcgcgccgatgaagtgctgcagaagaagctgcgc
agcctggccaacgtcaccgtgctgaccagcgcacagaccactgaagtgctgggcgacggc
agccgtgtcaccggcctggtctacaaggaccgcgtcggcggcgacgcccaccgcgtcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgaaggatgtg
gtggcgctgtcgccgcgtggcgagatcgtcatcgacgaccgcggccagaccaacctgccg
ggtgtgttcgctgctggcgattgcacgacggtgccctacaagcagatcatcatcgccatg
ggcgccggttcgaccgccgcactgagcgcgttcgaccacctgatccgctcgtcggtgagc
aacagcagcggtgccgttgctgaagcggcctga

DBGET integrated database retrieval system