KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1348Help
Entry
BurJV3_1348       CDS       T01596                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BurJV3_1348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buj02000]
    BurJV3_1348
Enzymes [BR:buj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BurJV3_1348
Transporters [BR:buj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BurJV3_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AEM50680
UniProt: G0K4S0
LinkDB All DBs
Position
complement(1524299..1524919)
Genome map
AA seq 206 aa AA seqDB search
MTSRQITLYHAARSRSSGAVALLEALGADYRMQVLDLKAGANLAPAYLAINPMGKVPAIV
HNGALVTEQVAIYLYLADLYPEAGLAPPIGDALRGPYLRWMAFYGACFEPAMIDKAMHRE
PPPRLMSPYNDAETVLQVIEAQLAQGPYLLGETMSAADVLWGNALAWTTAFGLVQPAPAT
ADYIARMSAMTAFDRSRQIDAELAAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgccagatcaccctgtaccacgccgcccgttcgcgctcgagcggcgccgtg
gccctgctcgaagcgctgggtgcggactaccgcatgcaggtgctggacctgaaggccggc
gccaacctggccccggcctatctggccatcaacccgatgggcaaggtgccggccatcgtc
cataacggtgcgctggtgaccgaacaggtggcgatctacctgtacctggccgacctgtat
ccggaggccggcctggcaccgccgatcggcgatgccctgcgcggcccctacctgcgctgg
atggccttctacggcgcctgtttcgagccggcgatgatcgacaaggcgatgcaccgcgag
ccgccgccgcgcctgatgtcgccgtacaacgacgccgagaccgtgctgcaggtgatcgag
gcccagctggcacagggcccctacctgctcggcgagacgatgagcgccgccgacgtgctg
tggggcaatgcgctggcctggaccacggccttcggcctggtgcagcctgcgccggccacg
gctgattacattgcacggatgagcgcgatgaccgccttcgaccgttcgcggcagatcgat
gcggagctggcggcggcgtaa

DBGET integrated database retrieval system