KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1562Help
Entry
BurJV3_1562       CDS       T01596                                 

Definition
(GenBank) sugar transporter
Organism
buj  Stenotrophomonas maltophilia JV3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 UPF0227 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AEM50891
LinkDB All DBs
Position
1716428..1717852
Genome map
AA seq 474 aa AA seqDB search
MSQAQSGTASHGGENTAFIVLISCVATLGGFLFGFDSGVINGTVDGLRQAFNSSEAALGF
EVASMLLGCAIGAFLAGWLGDRLGRRGVLIASALMFLVSALGAGAAHASWLFIAARVLGG
FAVGAASVMSPAYIAEVASARYRGRLATVQQMAIICGLFAAFLSNYLLARAAGASTEPLW
LGHEAWRWMFWMQALPSGLFLLLLLVIPESPRFLVLKGRQAQARAVLTRLYGEAAATAKQ
AEIEASLAQDQHKPRFSDLRDKVTGKLRPILWVGIGLAMFQQLVGINVVFYYGAVLWQAV
GFSESDALLINVLSGALSIGACLLTVLLIDRIGRKPLLWVGSVGMSVALVLMVVAFASGS
LVDGRLQLSDGMGRLALVAANVYVVFFNMSWGPVMWVMLGEMFPNQIRGPALAVAGAAQW
TSNFAITVTFPMLLAGIGLAGAYGIYAVAAILSIVFVVRYVRETKGKELEQMEG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagcccagtccggcaccgcctcccacggtggtgaaaacacggcgttcatcgtc
ctgatcagttgcgtggccacgctcggtggattcctgttcggtttcgacagtggtgtcatc
aacggcacggtcgatggcctgcgccaggccttcaactccagcgaggcggcgctgggtttc
gaagtcgcctcgatgctgctgggctgcgcgatcggtgcattcctggccggctggttgggc
gaccgcctggggcgccgtggtgtcctgatcgcgtccgcgctgatgttcctggtctcggcg
ctgggcgccggggcggcccacgcgtcctggctgttcatcgcggcccgcgtgctgggcggc
tttgcggtgggggcggccagcgtgatgtcgccggcctacatcgccgaagtcgcctcggcg
cgctatcgcggccggctggccacggtgcagcagatggcgatcatctgcggtttgttcgcg
gccttcctcagcaattacctgctggcccgcgccgccggcgcctcgaccgagcccttgtgg
ctgggccatgaggcctggcgctggatgttctggatgcaggcgctgccgtcggggttgttc
ctgctgctgttgctggtgatcccggaaagcccgcgtttcctggtactgaagggccgccag
gcgcaggcgagggcggtgctgacgcggctgtatggcgaggccgctgccacggccaagcag
gccgagatcgaggccagcctggcccaggaccagcacaagccacgcttcagtgatctgcgc
gacaaggtcaccggcaagctgcgcccgatcctctgggtgggcatcggcctggccatgttc
cagcagctggtcggcatcaatgtggtgttctactacggcgcggtgctgtggcaggcggtg
ggtttctcggaaagtgatgcgctgctgatcaatgtgctgtccggcgcactgagcatcggt
gcctgcctgctgacggtactgctgatcgaccgcatcggtcgcaagccgctgctgtgggtc
ggctcggtcggcatgtcggtggcgctggtgctgatggtggtggcgtttgccagcggcagc
ctggtcgatgggcgcctgcagctgtccgatggcatggggcggctggcgctggttgcggcc
aacgtctacgtggtgttcttcaacatgtcctggggcccggtgatgtgggtgatgctgggc
gagatgttccccaaccagatccgcggcccggcgctggccgtggcgggggccgcgcagtgg
acctcgaacttcgcgatcaccgtgaccttcccgatgctgctggccggcatcggcctggct
ggcgcctatggcatctacgcggtcgccgcgatcctctcgatcgtcttcgtggtccgctac
gtgcgcgagaccaagggcaaggagctggagcagatggaaggctga

DBGET integrated database retrieval system