KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1571Help
Entry
BurJV3_1571       CDS       T01596                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K15011  two-component system, sensor histidine kinase RegB [EC:2.7.13.3]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BurJV3_1571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:buj01001]
    BurJV3_1571
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:buj02022]
    BurJV3_1571
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BurJV3_1571
Protein kinases [BR:buj01001]
 Histidine kinases
  Other
   BurJV3_1571
Two-component system [BR:buj02022]
 Other families
  RegB-RegA (redox response)
   BurJV3_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2 DUF2427
Motif
Other DBs
NCBI-ProteinID: AEM50900
LinkDB All DBs
Position
complement(1725130..1726356)
Genome map
AA seq 408 aa AA seqDB search
MTGPDAPFLRTLCSLRWLAVGGQAATILVATWVLGLPLPQLPLWAGVAVLALFNIYTQLR
PEAADTAPLTAFGHILVDVIILTWMVGWSGGMANPFSSLFLILIALAAFALPLRWALAVA
LACLLGYAASGIFGQSLPDGYFRAQDLNRWGVVANFLISAAVVLAFSTRLALALRERELE
LSALRERFARNEGIVALATHAASVAHELNTPLATMTLLADDVAERSEEPEVREDMETLRE
LLVQCRERVLALAAPASADAPGRSHSSAQQVLEQWRLVRPTIDLHRNDDAPLRLPLDPGV
GHLLMVLLNNAADAGEKAGRPRVDLDLRIEGDDLIGEVRDYGHGFDARAAVLPGKLFGSS
KSEGMGVGLALSHATIERLDGEMWMRPAQGAGSRVGFRLPLAPREDTP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtcccgacgccccgtttctccgtaccctgtgcagcctgcgctggcttgccgta
ggcggccaggccgccaccatcctggttgccacctgggtgctgggcctgccgttgccgcaa
ctgccgctatgggccggcgtggcggtgctggccctgttcaacatctatacccagttgcgc
ccggaagcggccgacaccgcgccgctgaccgcattcggccacatcctggtggacgtgatc
atcctgacctggatggtcggctggagcggtggcatggccaacccgttcagttcactgttc
ctgatcctgatcgcactggccgcattcgccctgcccctgcgctgggcgctggcggtcgcg
ctggcctgcctgctcggctacgccgccagcggcatcttcgggcaatcgctgccggacggc
tatttccgcgcgcaggacctcaatcgctggggcgtggtcgccaacttcctgatttccgct
gcggtggtgctggccttctccacccgcctggcactggccctgcgggagcgcgaactggaa
ctgtcggcactgcgcgagcgcttcgcccgcaacgagggcatcgtcgccctggccacccat
gccgcctcggtggcgcatgaactgaacacgccgctggcgacgatgaccctgctcgccgac
gacgtcgccgagcgcagcgaagagccggaagtgcgcgaggacatggaaaccctgcgcgag
ctgctggtgcagtgccgggagcgcgtgctggcgctggctgctccggcctcggccgacgca
ccgggccgcagccactccagcgcccagcaggtgctggagcaatggcgcctggtgcggccg
accatcgacctgcaccgcaacgacgatgcgccgctgcggctgccgctcgacccgggcgtg
ggacatctgctgatggtcctgctcaacaacgccgccgatgccggcgagaaggccggccgg
ccgcgcgtggacctggacctgcgcattgaaggcgacgacctgatcggcgaagtccgcgac
tacggccatggcttcgacgcccgtgccgccgtgctgccgggcaagctgttcggcagcagc
aagagcgagggcatgggcgtcggcctggccctgtcccatgccaccatcgaacgcctcgac
ggcgagatgtggatgcgcccggcccagggggccggcagccgcgtcggcttccgcctgccg
ctggccccacgcgaggacaccccatga

DBGET integrated database retrieval system