KEGG   Burkholderia sp. KJ006: MYA_0254Help
Entry
MYA_0254          CDS       T02110                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:buk03012]
    MYA_0254
   03029 Mitochondrial biogenesis [BR:buk03029]
    MYA_0254
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:buk04147]
    MYA_0254
Translation factors [BR:buk03012]
 Eukaryotic Type
  Elongation factors
   MYA_0254
 Prokaryotic Type
   MYA_0254
Mitochondrial biogenesis [BR:buk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MYA_0254
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYA_0254
  Exosomal proteins of breast cancer cells
   MYA_0254
  Exosomal proteins of colorectal cancer cells
   MYA_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: AFJ84623
UniProt: I2DIZ7
LinkDB All DBs
Position
1:284723..285913
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtcaacgttggtacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggtgctgacgaagaagttc
ggcggcgaagcgaaggcctacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgttgagtacgaaacggcgaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgcgagcacatc
ctgctggcacgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggccaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgaacctggcagacgcactggacacg
tacatcccgacgccggagcgtgcggttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgcgtcgagcgcggcatcgtgaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcatacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgattgcgccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtaccgtcggcgctggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system