KEGG   Burkholderia sp. KJ006: MYA_0527Help
Entry
MYA_0527          CDS       T02110                                 

Definition
(GenBank) Exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:buk03016]
    MYA_0527
Enzymes [BR:buk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     MYA_0527
Transfer RNA biogenesis [BR:buk03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    MYA_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AFJ84895
UniProt: I2DJR9
LinkDB All DBs
Position
1:568762..570870
Genome map
AA seq 702 aa AA seqDB search
MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEFEKPAASELMQEADTA
AQQIDLDFLWECAPAEEFAYTTLAAEYFGAGYGPVERAALVLRLHGSPVYFRRKGRGQYQ
RAPEEQLKMALASLERKRQQALVQAQYEEELKEGKLPQAFAGKVLALLTRPDKNSIEYKA
LEAAAGARGVSPARLMLDCGGIESARALHEARFLAEFFPHGTGFPPVAVGPLPDDLPRAD
VNAFSIDDITTTEIDDAFSVEHLADGRVRIGVHIAAPALGIVRGDAVDAIARARLSTVYM
PGDKITMLPDDVVDVFTLKEGDYRPALSLYIIVDRDTQEIVANETRAELVYVKNNLRHNT
LDELVNEETLAAGTGDYPHKDDIAVLWPLAQALFEKRQVARAGYGLKREVQRNTDYNFYV
EGEHVTITPRRRGSPLDLIVSELAILANSTWGAFLHDHTVPGIYRSQRGFGAPGPKRTRM
QTTAAPHEGLGVAQYAWSTSPLRRYVDLVNQWQLLACVQHGVTAKLAAPFKPKDADLYAV
VQGFDDTYSAYADYQRRMEYFWCLRWLAQEQKKQVVASVVKGDLVRLEEIPLLLHVPGLG
VHARGTRVLLEVMSLDELTIEASVRPLSVLDAPTVTSGDGADEEDDAEGEGGDDTLVDAQ
DASAESEAEALAESDGAVAEGGDAATGGEHESEPESAPGRAS
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttttcttcgaggaatcgggcagtttcaaggcgggcagcgtgctgtcgcgccag
ggcgacgcgtttcaggtcgagttgcccggcgggcggcgcgcgaaggtgcgcgcaaaggac
gtgctgatcgagttcgagaagccggccgcgagcgagctgatgcaggaagccgacacggcc
gcgcagcagatcgacctcgacttcctgtgggaatgcgcgccggcggaggaattcgcctat
acgacgctggccgccgaatacttcggcgcgggctacggcccggtcgagcgcgcggcgctg
gtgctgcggctgcacggctcgcccgtgtacttccgccgcaagggccgcggccaatatcag
cgcgcgccggaagagcagctgaagatggcgctcgcgtcgctcgagcgcaagcgccagcag
gcgctggtgcaggcgcagtacgaagaggagctgaaggaaggcaagctgccgcaagcgttc
gccggcaaggtgctcgcgctgctgacgcgaccggacaagaattcgatcgaatacaaggcg
ctcgaggcggcggccggggcgcgcggcgtgtcgcccgcgcggctgatgctcgactgcggc
ggcatcgagtccgcccgcgcgctgcacgaggcgcgctttctcgccgagttcttcccgcac
ggcacgggctttccgcccgtcgcggtcggcccgctgccggacgacctgccgcgcgcggac
gtcaacgcgttctcgatcgacgacatcacgacgaccgaaatcgacgacgcgttctcggtc
gagcatctggcagacggccgcgtgcggatcggcgtgcacatcgcggcgccggcgctgggc
atcgtgcgcggcgacgcggtcgacgcgatcgcgcgcgcgcgtctgtcgacggtctacatg
ccgggcgacaagatcacgatgctgccggacgacgtggtcgacgtcttcacgctgaaggag
ggcgactaccgcccggcgctgtcgttgtacatcatcgtcgatcgcgatacgcaggagatc
gtcgcgaacgagacgcgcgccgagctcgtgtacgtgaagaacaacctgcgccacaacacg
ctcgacgagctggtcaacgaggagacgctcgcggccggcaccggcgattacccgcacaag
gacgacatcgcggtgctgtggccgctcgcgcaggcgctgttcgagaagcgccaggtcgcg
cgcgcgggctacggcctgaagcgcgaggtgcagcgcaataccgactacaacttctacgtc
gaaggcgagcacgtgacgatcacgccgcgccgccgcggctcgccgctcgacctgatcgtg
tcggagctggcgatcctcgcgaactcgacctggggcgcgttcctgcacgatcacacggtg
ccgggcatctaccgctcgcagcgcggcttcggcgcgccgggcccgaagcgcacgcggatg
cagacgacggccgcgccgcacgaagggctcggcgtcgcgcagtatgcgtggagcacgtcg
ccgctgcgccgctacgtcgacctcgtgaaccagtggcagctgctcgcctgcgtgcagcac
ggcgtcaccgcgaagctcgccgcgccgttcaagccgaaggacgccgacctgtacgcggtc
gtgcagggcttcgacgacacctatagcgcctacgccgactaccagcgccggatggaatac
ttctggtgcctgcgctggctcgcgcaggagcagaagaagcaggtagtcgcgagcgtcgtg
aagggcgatctcgtgcgcctcgaggaaattccgctgctgctgcacgtgccggggctgggc
gtgcatgcgcgcggcacgcgcgtgctgctcgaggtgatgtcgctcgacgagctgacgatc
gaggcgtcggtgcgaccgctgagcgtgctcgacgcgccgaccgtgacgagcggcgatggg
gccgacgaagaagacgacgccgaaggcgaaggcggcgacgacacgctggtcgacgcgcag
gatgcgtcggcggaatcggaagccgaggcgctggccgaatcggacggcgccgtggccgaa
ggcggcgacgccgcaaccggcggcgagcacgaaagcgagccggaaagcgcaccggggcgc
gcatcatga

DBGET integrated database retrieval system