Burkholderia sp. KJ006: MYA_1459 Help Entry MYA_1459          CDS       T02110                                  Name (GenBank) Putative MbtH-like protein   KO K05375   MbtH protein Organism buk  Burkholderia sp. KJ006 Pathway buk00261   Monobactam biosynthesis buk01100   Metabolic pathways buk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:buk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MYA_1459  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:buk01008]     MYA_1459 Polyketide biosynthesis proteins [BR:buk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MYA_1459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFJ85821 UniProt:  I2DME5 LinkDB All DBs Position 1:1562331..1562573 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRAVPAGWREVGVRGPKADCLAHIDAVWT DMRPASLRRAMDGEPASRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgcggacaccgacgacctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccgggcggtgccggccggctggcgc gaggtcggcgtgcgcggcccgaaggccgactgcctcgcgcacatcgacgccgtgtggacc gacatgcgcccggcgagcctgcgccgcgcgatggacggcgagcccgcttcccgcgcgtcg tga

DBGET integrated database retrieval system