KEGG   Burkholderia sp. KJ006: MYA_2018Help
Entry
MYA_2018          CDS       T02110                                 

Definition
(GenBank) Glutathione S-transferase N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYA_2018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buk02000]
    MYA_2018
Enzymes [BR:buk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYA_2018
Transporters [BR:buk02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYA_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: AFJ86378
UniProt: I2DP02
LinkDB All DBs
Position
1:complement(2200154..2200810)
Genome map
AA seq 218 aa AA seqDB search
MLQLCGVPLSNYYNKVKFVLLEHDIPFEETKCSLPISDPALLADSPLGKIPFVKTEEGAL
FESQAIIEYLAARHPDKAIFPSAPFAAAKVRELVETLELYLEWTAREVYTEAFFGGKVSD
AMKAHVEKRLPRAIDAFKRLTQFSPYVLGDSFGLADIAAFVHLPVLGMATKAIYDRDFLL
DAGIDWKAHAKLVGARPAAQRVAADRKAYVEAANLARS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttgtgcggtgttccgttgtccaactactacaacaaggtgaagttcgtgctg
ctcgagcacgacatcccgttcgaggaaaccaaatgcagcctgccgatcagcgatccggcg
ctgctggccgattcgccgctcggcaaaatcccgttcgtgaagaccgaagagggcgcgctg
ttcgagtcgcaggcgatcatcgagtatctggccgcgcggcatccggacaaggcgatcttc
ccgtcggcgccgtttgcggccgcgaaggtgcgcgagctcgtcgagacgctcgagctgtat
ctcgaatggaccgcgcgcgaggtctataccgaggcgtttttcggcgggaaggtgagcgac
gcgatgaaggcgcacgtcgagaagcgcctgccgcgcgcgatcgatgcgttcaagcggctc
acgcagttttcaccgtacgtgctcggcgatagcttcggtcttgccgacatcgccgcgttc
gtccatctgccggtgctcgggatggcgacgaaggcgatctacgatcgtgattttctcctc
gacgcgggcatcgactggaaggcgcacgcgaagctggtgggcgcacggcccgccgcgcag
cgcgtggccgccgaccgcaaggcgtacgttgaagcggcaaacctcgcgcgttcgtaa

DBGET integrated database retrieval system