KEGG   Burkholderia sp. KJ006: MYA_2222Help
Entry
MYA_2222          CDS       T02110                                 

Definition
(GenBank) Alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00860  Porphyrin and chlorophyll metabolism
buk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYA_2222
Enzymes [BR:buk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     MYA_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DoxX_2
Motif
Other DBs
NCBI-ProteinID: AFJ86582
UniProt: I2DPK6
LinkDB All DBs
Position
1:complement(2416081..2416665)
Genome map
AA seq 194 aa AA seqDB search
MDVVLIRHPAVGVERGVCYGRSDVPLAESADAGAQAVRARLAALGAPLPEQIWTSPLARC
ASVAERLAHAVDAPLRPDPRWQEMDFGAWELQRWDDIDRAALDAWAADLLHACAHGGESV
AQFAARVAQVAAAVEQAGVAQWALTHAGVIRAFAAYALRVPLDTLLARPVPTGGVVWLRM
SEAAGAWKIVHWDA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtcctgattcgccatccggccgtcggcgtcgagcgcggcgtgtgctacggg
cgcagcgacgtgccgctcgcggaatcggcggacgccggtgcgcaggcggtgcgtgcgcgt
ctcgcggcgctgggcgcgccgttgccggagcagatctggacgagcccgctcgcgcgctgc
gcgtcggtcgccgaacggctcgcacacgcagtcgacgcgccgttgcggccggacccgcgc
tggcaggagatggacttcggcgcgtgggagctgcagcgttgggacgacatcgaccgcgcc
gcgctcgatgcgtgggcggccgatctgctgcatgcatgcgcgcacggcggcgagagcgtc
gcgcagttcgccgcgcgcgtcgcgcaggtggcggctgcggtcgagcaggcgggcgtcgcg
caatgggcgctcacgcatgcgggcgtgattcgcgcgttcgccgcgtacgcgttgcgcgtg
ccgctcgacacgctgctcgcgcgaccggtgccgacgggcggggtcgtgtggctgcggatg
agcgaggcggccggtgcgtggaagatcgtccactgggacgcgtag

DBGET integrated database retrieval system