KEGG   Burkholderia sp. KJ006: MYA_2289Help
Entry
MYA_2289          CDS       T02110                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00480  Glutathione metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
buk01210  2-Oxocarboxylic acid metabolism
buk01230  Biosynthesis of amino acids
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_2289
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYA_2289
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MYA_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phage_SSB
Motif
Other DBs
NCBI-ProteinID: AFJ86649
UniProt: I2DPS3
LinkDB All DBs
Position
1:complement(2484579..2485835)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHTYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGIKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGAEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGDVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgaaggcgacggtaccggc
ttcgacatcacgccggtgatgatcaaggtcgtcgatgcggcggtcgcgcatacgtacaag
ggcaagcgcaagatccactggatggagatcttcgccggcgagaaggcgacgaaggtgtac
ggcccggacgtatggctgcccgacgaaacgctgcaggtgctgaaggaatacgtcgtttcg
atcaaggggccgctcacgacgccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctctacgtgtgcctgcgcccgatccagtatttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgagtgggcggccggctccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcatc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggttatgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggtggcccgtggatgcgcgtgaagaacccgaagacgggcgccgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgccacgctgaacctgaacggcgactacgtctccgacgcactggccgcgcaggtcggc
gggatcgggatcgcgccgggtgcgaacctgtcggactcggtcgcgatgttcgaggcgacc
cacggcacggcgccgaagtacgcgggcaaggactacgtgaaccccggttccgagatcctg
tcggccgaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggtgcgacgcaggtgtcgtgctcgggcttcggcgacgtgctgatcgagaacatgtaa

DBGET integrated database retrieval system