KEGG   Burkholderia sp. KJ006: MYA_3219Help
Entry
MYA_3219          CDS       T02110                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00250  Alanine, aspartate and glutamate metabolism
buk00410  beta-Alanine metabolism
buk00640  Propanoate metabolism
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYA_3219
   00650 Butanoate metabolism
    MYA_3219
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYA_3219
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYA_3219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buk01007]
    MYA_3219
Enzymes [BR:buk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MYA_3219
Amino acid related enzymes [BR:buk01007]
 Aminotransferase (transaminase)
  Class III
   MYA_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFJ87578
UniProt: I2DSF2
LinkDB All DBs
Position
2:328709..329992
Genome map
AA seq 427 aa AA seqDB search
MKNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNCFTHTAYQIVPYASYVELAEKINARAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNPLHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPADFVRALRKICNEHGIMLIADEV
QTGFARTGKLFAMQQYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLDIIDEEKLCERATQLGDALKAKLNALRADIAPIADVRGPGAMVAVEFVN
PATGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALTILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcatgcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgaaaacgcggagctgtgggacgtcgagggccgc
cgcttcatcgatttcgccgccggcatcgccgtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgccgaccagctgaactgcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggctgaaaagatcaacgcgcgcgcaccgggcgactac
ccgaaaaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcgcgtgcggcaaccggccgtccgggcgtcatcgcgttcgccggcgggttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcaccgtacaagctgaacttcggtccg
ttcccgggcgacgtgttccacgcaccgtacccgaacccgctgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgacttc
gtgcgcgcactgcgcaagatctgtaacgagcacggcatcatgctgatcgccgacgaagtg
cagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcagtacgacgtgctggcc
gacctgatcacgatggccaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggcagcgcccggcggcctcggcggcacgtacgcgggcaac
ccgctcgccgtcgcgtcggcgcacgcggtgctcgacatcatcgacgaagagaagctgtgc
gaacgcgcgacgcaactgggcgacgcgctgaaggcgaagctgaacgcgctgcgcgccgac
atcgcaccgatcgccgacgtgcgcggtccgggcgcgatggtcgcggtcgagttcgtgaac
ccggccacgggcgagcccgacgccgacttcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcggtctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgattccgcaggccgtgttcgacgaagcgctcacgatcctcgaggaagtgctgaag
gaaacggtcggcgtaccggcctga

DBGET integrated database retrieval system