KEGG   Burkholderia sp. KJ006: MYA_4055Help
Entry
MYA_4055          CDS       T02110                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00190  Oxidative phosphorylation
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_4055
   00650 Butanoate metabolism
    MYA_4055
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYA_4055
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYA_4055
    1.3.5.4  fumarate reductase (quinol)
     MYA_4055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 HI0933_like Lycopene_cycl GIDA Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFJ88413
UniProt: I2DUT7
LinkDB All DBs
Position
2:1214315..1216090
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALRFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVQHVKNQRDHKPLPADAGEYSLARLAKLEKSTSGEYTQDVANDIRSTMQKHAGVFRTS
ALLKEGVDQMAGLKERVENIHLKDKSKVFNTARIEALELENLIEVARATMVSAEARKESR
GAHAHSDYEHRDDDNWLRHTLWYSEGDRLDYKPVQMKPLTVDSVPPKPRTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgccgcaagttcgacgtggtgatcgtcggcgcg
ggcggctcgggcttgcgcgcagcgctgcaactgtcgcgtgcgggcctgtcggtcggcgtg
ctgtcgaaggtgttcccgacccgttcgcacacggtcgcggcacaaggcggcatcggcgcg
tcgctcggcaacatgagcgaagacaactggcacttccatttctacgacacgatcaagggt
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgtgaagcgccgaacgtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaacgcggacggcacgatctat
cagcgcccgttcggcggccacactgcgaactacggcgagaagccggtgcagcgcgcctgc
gcggccgccgaccgtaccggtcacgcgctgctgcacacgctgtaccagcagaacgtcgag
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgagatggagacgggcgacgtctacatcatggaaggc
aagacgacgctgttcgcgacgggcggcgctggccggatcttcgcggcatcgacgaacgcg
ttcatcaacacgggcgacgggctgggcatggccgctcgctcgggcatcgcgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcacggaa
ggcgtgcgcggcgagggcggcattctgcgcaactcgaacggcgagcgcttcatggagcgc
tatgcgccgacgctgaaggatctggcgccgcgtgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtcggtccgaacaaggaccacgtgctgctggatctgtcg
cacatcggcgcggagacgatcatgaagcgtctgccgtcgatccgcgagatcgcgctgcgg
ttcgcgaacgtcgactgcatcaaggaaccgatcccggtcgtgccgacgatccactaccag
atgggcggcattccgaccaacatccacggtcaggtcgtgggcacgtcgcgcgatcacaag
gagccggtcaacggcttctacgcggtcggcgaatgctcgtgcgtgtcggtgcacggcgcg
aaccgcctgggcacgaactcgctgctcgacctagtggtgttcggccgcgcggccggcaac
cacatcgtccagcacgtgaagaaccagcgcgaccacaagccgctgccggccgacgcgggc
gaatactcgctggcacgcctggcgaagctcgagaagtcgacgtcgggcgaatacacgcag
gacgtcgcgaacgacatccgctcgacgatgcagaagcatgcgggcgtgttccgtacctcg
gcgctgctgaaggaaggcgtggaccagatggccggcctgaaggagcgggtggaaaacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcatcgaagcgctcgagctggag
aacctgatcgaagtggcccgtgcgacgatggtgtcggccgaagcgcgcaaggaaagccgc
ggcgcacacgcgcacagcgactacgagcaccgcgacgacgacaactggctgcgccacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagccggttcaaatgaagccgctgacg
gtcgactccgtgccgccgaagccgcgcacgttctaa

DBGET integrated database retrieval system