KEGG   Burkholderia sp. KJ006: MYA_4056Help
Entry
MYA_4056          CDS       T02110                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00190  Oxidative phosphorylation
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_4056
   00650 Butanoate metabolism
    MYA_4056
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYA_4056
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYA_4056
    1.3.5.4  fumarate reductase (quinol)
     MYA_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: AFJ88414
UniProt: I2DUT8
LinkDB All DBs
Position
2:1216112..1216813
Genome map
AA seq 233 aa AA seqDB search
MAKRIFELYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKAVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMTHFFNQYHSIKPYLIND
APPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcatttttgaactctatcgctacgatccggacaaggacgcggcgccgcgc
atgcagacgtacgagctcgagatccagcatgagcgcatgctgctcgacgcgctggtgaag
ctgaaggccgtggacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggtctcgcgtgcctgacgaacctgaacgat
ctgccgcagaagatcgtgctgcgtccgctgccggggctgccggtggtgcgcgacctgatc
gtcgacatgacgcacttcttcaaccagtatcactcgatcaagccgtacctgatcaacgac
gcgccgccgccggagaaggaacgcctgcagtcgccggaagagcgcgacgagctcgacggc
gtgtacgagtgcattctgtgtgcgagctgctcgacgtcgtgcccgagcttctggtggaac
ccggacaagttcgtgggcccggcgggcctgctgcaggcttaccggttcatcgccgacagc
cgcgacaccgccaccggcgagcgtctcgacaatctggaagatccgtaccgtctgttccgt
tgccatacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaatccgacgaaggcg
atcggcaagatcaaggaactgatggttcgccgcgcggtttaa

DBGET integrated database retrieval system