KEGG   Burkholderia sp. KJ006: MYA_4325Help
Entry
MYA_4325          CDS       T02110                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00550  Peptidoglycan biosynthesis
buk01100  Metabolic pathways
buk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MYA_4325
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MYA_4325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:buk01003]
    MYA_4325
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buk01011]
    MYA_4325
Enzymes [BR:buk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     MYA_4325
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MYA_4325
Glycosyltransferases [BR:buk01003]
 Polysaccharide
  Bacterial polysaccharide
   MYA_4325
Peptidoglycan biosynthesis and degradation proteins [BR:buk01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   MYA_4325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AFJ88681
UniProt: I2DVK5
LinkDB All DBs
Position
2:complement(1521388..1523916)
Genome map
AA seq 842 aa AA seqDB search
MRELLAKWAARAQPVAAAAAVPVKRVLASAWRHLRHPTRRGALRAAAAVPVLFLLYVLAL
IPFTPGIGDIRKARVDQPAQVLSADGKVLAEFKPSNREWVSLKQISPHMVDALIATEDHR
FYEHHGLDWKRTASAALHTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKVKEAITAL
KIEAVYSKEQILETYLNTVPFLYNAYGVEMAARTYFDKSADELDVLDAATLVGMLKGNSY
YNPVLNPERALQRRNTVLAQMVKYGKLSAAQFAQLQRRPLRIDFERQKEPPGPAPHFAQQ
LRKWLIGWADRNDYNIYSDGLIVRTTIDSRLQQIATQALTQQANQLQGIANNAWSGSDGC
GTDNEVFRTFMRESPEYKAAQDAGKNDAAAMKQLAADRGFMRALCKAKTDVQAGFVAIDP
RDGQIRAWVGSRDFTSEPFDHVAQARRQPGSTFKPFVYGAAFASGMTPDDTFIDQPVEIP
LKGGEIWRPNDDVPPSGKPMTLRDALALSRNRITAQVMEKVGPAAVARLARDMGVRESPL
ERVPSLALGTSPVTLKEMVASYATIANGGLYTEPQMVTRIENRQGDVLAEYAPAPPERAL
DGETDKTLLDVMRDVVTRGTGSSIRTRFGVRGDVAGKTGTTQDNADGWFILMQPGLVAGA
WVGFDDGRVTLRSDYWGQGAHSALPIVGEFFQRAQRARIVDAKLKFDTEPSPGWFASVRE
RVTDLFDGWFGPEPKKAPTRIRTQRIERQPDADADAAAASAASAASAPEAASGGIVEQWI
PASEVAASAAAISGGASQAPVLPPPAAGSAGNAGGAGPGAASGVAPGSAPAPASPESASS
SQ
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagctccttgccaaatgggccgcgcgcgcccaacccgtcgcggccgctgccgcc
gtgcccgtcaagcgcgtactggccagcgcctggcgccatctccgccatccgacgcgacgc
ggcgcgttgcgcgccgccgccgccgtgcccgtgctgttcctgctctacgtgctcgcgctg
ataccgtttacgccgggcatcggcgacatccgcaaggcgcgcgtcgatcagcccgcgcag
gtgctgtccgccgacggcaaggtgctcgcggaattcaagccgtcgaaccgcgaatgggtg
tcgctcaagcagatctcgccgcacatggtcgacgcgctgatcgcgaccgaggaccatcgc
ttctacgagcaccacggcctcgactggaagcgcaccgcgtcggcggcgctccatacgttc
tcgggcgatcgccagggcggctcgacgatcacgcagcagctcgcgcgcaacctctatccg
gacgagatcggccgcgcgccgacgctcacgcgcaaggtaaaggaagcgatcaccgcgctg
aagatcgaggccgtgtacagcaaggagcagatcctcgagacctacctgaacacggtgccg
ttcctgtacaacgcgtacggcgtcgagatggccgcgcgcacctatttcgacaagtcggcc
gacgagctcgacgtgctcgacgccgcgacgctggtcgggatgctcaagggcaacagctac
tacaacccggtgctcaatccggagcgcgcgctgcagcgtcgcaacacggtgctcgcgcag
atggtgaagtacggcaagctgtcggcggcgcagttcgcgcagttgcagcggcggccgttg
cgcatcgacttcgagcgtcagaaggagccgccggggccggcgccgcacttcgcgcagcag
ctgcgcaaatggctgatcggctgggccgaccgcaacgattacaacatctattcggatggg
ctgatcgtgcgcacgacgatcgattcgcggcttcagcagatcgcgacgcaggcgctgacg
cagcaggcgaaccagctgcagggcatcgcgaacaatgcgtggagcggcagcgacggttgc
ggcacggacaacgaggtgtttcgcaccttcatgcgcgagtcgcccgaatacaaggcggcg
caggacgccggcaagaacgacgcggccgcgatgaagcagctcgcggccgaccgcggcttc
atgcgcgcgctgtgcaaggccaagaccgacgtgcaggccggtttcgtcgccatcgatccg
cgcgacgggcagattcgcgcgtgggtcggcagtcgcgatttcacgagcgagccgttcgat
cacgtcgcacaggcgcggcgtcagcccggctcgacgttcaagccgttcgtatatggcgcc
gcgttcgcgagcgggatgacgcccgacgacaccttcatcgaccagccggtcgagattccg
ctgaagggcggcgagatctggcggcccaacgacgatgtgccaccgtcgggcaagccgatg
acgttgcgcgatgcgctcgcgctgtcgcgcaaccggatcaccgcccaggtgatggagaag
gtcggcccggcggccgtcgcgcggctcgcacgcgacatgggcgtgcgcgaaagcccgctc
gagcgcgtgccgtcgcttgcgctcggcacgagcccggtgacgctgaaagagatggtcgcg
tcgtacgcgacgatcgcgaacggcgggctgtacaccgagccgcagatggtgacgcgcatc
gaaaaccggcagggcgacgtgctggccgaatacgcgccggcgccgcccgaacgcgcgctc
gacggcgaaaccgacaagacgctgctcgacgtgatgcgcgacgtcgtcacgcgcggcacc
ggcagcagcatccgcacgcgtttcggcgtgcgcggcgacgtggccggcaagaccggcacc
acgcaggacaacgcggacggctggttcatcctgatgcagccgggactggtggccggcgcc
tgggtcggcttcgacgacggtcgcgtgacgctgcgcagcgactattgggggcagggcgcg
cacagcgcgctgccgatcgtcggcgagttcttccagcgggcgcagcgcgcgcggatcgtc
gatgcgaagctgaaattcgataccgagccgtcgccggggtggttcgcgtcggtgcgggag
cgcgtaaccgacctgttcgacggctggttcggacccgagccgaagaaggcgccgacgcgc
atcaggacgcagcgtatcgagcggcaacccgacgccgacgccgatgcggccgcggcttcg
gcggcctctgcagcatcggcgccggaggctgcgtccggcggcatcgtcgagcaatggatt
ccggcatccgaggtggccgcatcggcggctgcgatatcgggcggcgcgtcgcaagcaccg
gtcttgccgccgccggcagccggcagcgcggggaacgcgggcggcgccgggccgggtgcg
gcatcgggcgtcgcgcctgggtcggcgccggcgcctgcgtcgccggagagcgccagcagt
tcgcaatga

DBGET integrated database retrieval system