KEGG   Burkholderia sp. KJ006: MYA_4542Help
Entry
MYA_4542          CDS       T02110                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00440  Phosphonate and phosphinate metabolism
buk01100  Metabolic pathways
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    MYA_4542
Enzymes [BR:buk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     MYA_4542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AFJ88896
UniProt: I2DW70
LinkDB All DBs
Position
2:1766659..1768344
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSDQLEFLMEAHNGLSARIVREAGFRGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGAPHGRWIGLLNVR
GAGVERLKAMLATLQARADFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTTNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcgcgcctgcgccgcatgctg
gtcagcgaccagctcgagttcctgatggaagcgcacaacggcctgtcggcgcggatcgtg
cgcgaagccggtttcaggggaatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gatgcgagcgacttgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgccgaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagattctgcagttcgcgcgcgaatggagcggcaaggccccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcctccgcgatgcaggccgtcgcacgcgag
atccacgagaacgaaacgctgatcaacgtcgaggaccgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgtgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctggtcgtgaacgagcgccatgcacagacg
ggcgagctcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggcggag
ttcagcgtcgtcgtcgattcgtcgctgaccgaaaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggcggccgacgatcgcgggctgttcggtcagaagacgtatctgcaacgcgtg
tcgagcgacgttgccgccggcgcgccgcacggccgctggatcggcttgctgaacgtgcgc
ggcgcgggcgtcgagcggctgaaggcgatgctcgcaacgctgcaggcgcgcgccgacttc
gacacgctcgacatcccgtcgctgctcaacgagctgatcgccgccggcgagaagatcgaa
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgtcgcgcg
ggcgacttcgcgcacggccagacgccgctgtcggagccgggcaccaccaacggaggcgcg
caatga

DBGET integrated database retrieval system