KEGG   Burkholderia sp. KJ006: MYA_4578Help
Entry
MYA_4578          CDS       T02110                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buk  Burkholderia sp. KJ006
Brite
KEGG Orthology (KO) [BR:buk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MYA_4578
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MYA_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO K_oxygenase NAD_binding_8 Thi4 FAD_binding_3 AlaDh_PNT_C FAD_oxidored Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AFJ88932
UniProt: I2DWA6
LinkDB All DBs
Position
2:1807182..1808780
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDGAKSRELLALLNEIASLTSRVTVIERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDFA
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQDEVDARQIMAVPTMFLNGAT
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFAAALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGNKL
NALVYKDLQSGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGGTSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPVTTAAPQPAEALAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcaactgaaagcgtacctcgaaaagatcacccgcccg
atcgaactcgtcgcctcgctcgacgacggtgcgaaatctcgggaactgcttgcgctgctg
aacgagattgcgtcgctgacgtcgcgcgtgaccgtcatcgagcgccgcgacgatgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
attccgatgggccacgaattcacgtcgctcgtcctcgcgctgctgcagaccggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagattcgcgcgctcgacggcgacttcgcg
ttcgaaacgtatttctcgctgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcactgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
gatgaagtcgacgcgcgccagatcatggccgtcccgacgatgttcctgaacggcgcaacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacaccggcgcgagc
gcacgcgccgccaagtcgctcgaaaacaagccggtgttcgatacgctgatcgtcggcggc
ggcccggccggcgcggccgcggcgatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggccatcgaaaacttcgtgtcg
gtgcaggaaaccgaagggccgaagtttgcggccgcactcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaggcgctgatccccggcgacgtgcatcag
atccgcctcgcgaacggcgcagtgctgaaggcgaagacgatcgttctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaaccgcggcgtcgcctac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggcggcggc
aactccggcgtcgaggcggcgatcgacctcgccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcacaactgcgcgccgacgaggtgctgcagcgcaagctgcgcagcctgccg
aacgtcacgatcgtcacgcaagcgcagacgaccgagctgaccggcgacggcaacaagctg
aacgcgctcgtctacaaggatctgcagtcgggcgaaactaaacgtatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaagggacggtcgagctg
tcgaagcacggcgagatcgtcgtcgacgcccgcggggggacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggttccgttcaagcagatcgtgatcgcagtcggcgaaggt
gcgaaggcatcgctcggcgcgttcgatcacctgatccggcaggacgcgacgccggtcacg
accgccgcgccgcagcccgccgaagcactcgccgcgtaa

DBGET integrated database retrieval system