KEGG   Burkholderia sp. KJ006: MYA_5334Help
Entry
MYA_5334          CDS       T02110                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00190  Oxidative phosphorylation
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_5334
   00650 Butanoate metabolism
    MYA_5334
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYA_5334
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYA_5334
    1.3.5.4  fumarate reductase (quinol)
     MYA_5334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AFJ89679
UniProt: I2DYF3
LinkDB All DBs
Position
3:326190..326987
Genome map
AA seq 265 aa AA seqDB search
MHVDARPAGMAFAGRPRTLSPDAGAVPGGTMNDPRTLHIYRYDPDRDAAPYMQRYEIDVS
ADDRMLLDVLGRLKHDDETLSYRRSCREGICGSDAMNINGKNGLACLTNMKTLPREIVLR
PLPGLPVVRDLIVDMTDFFNQYHSIRPYLINDTTPPERERLQTPEERDQLDGLYECILCA
CCSTACPSYWWNPDKFVGPAGLLQAYRFIADSRDMATAERLDDLEDPYRLFRCRTIMNCT
DACPKGLNPTKAISEIRTMLVRRTV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttgatgcgcggccggccggtatggcgtttgcgggccggccgcgcaccttgtca
cccgatgccggcgccgtgccgggaggaaccatgaacgatccgcgtacgcttcatatctac
cgttacgatcccgaccgcgacgccgcgccgtacatgcagcgctacgagatcgacgtgagc
gccgacgaccgcatgctgctcgacgtgctcggacgcctgaagcacgacgacgagacgctg
tcgtaccggcgctcgtgccgcgaggggatctgcggctccgatgcgatgaacatcaacggc
aagaacgggctcgcgtgcctgaccaacatgaagacgctgccgcgcgagatcgtgctgcgg
ccgctgcccgggttgccggtggtgcgcgatctgatcgtcgacatgacggacttcttcaac
cagtaccactcgatacggccttacctgatcaacgacacgacgccgcctgaacgcgagcgg
ttgcagacgccggaggagcgcgaccagctcgacgggctgtatgagtgcattttgtgtgcg
tgctgttcgactgcctgccccagttattggtggaacccggacaagttcgtcggcccggcg
gggttgctgcaggcgtatcggttcattgcggattcgcgcgatatggcgacggccgagcgg
ctcgatgatctcgaggatccgtatcggctgttccggtgccggacgatcatgaattgcacg
gatgcgtgtccgaagggattgaatccgacgaaggcgatttcggagattcggacgatgttg
gtcaggaggacggtttag

DBGET integrated database retrieval system