KEGG   Burkholderia sp. 2002721687: BW21_1168Help
Entry
BW21_1168         CDS       T03759                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00970  Aminoacyl-tRNA biosynthesis
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BW21_1168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bul03029]
    BW21_1168
Enzymes [BR:bul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BW21_1168
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BW21_1168
Mitochondrial biogenesis [BR:bul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BW21_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJY40869
UniProt: A0A0D5LB40
LinkDB All DBs
Position
I:complement(1261420..1262796)
Genome map
AA seq 458 aa AA seqDB search
MTTFAPFPPLARLAADLAAGTTTSRALVEAALERIADPAGQGALAFTEVDAQGARAAADA
HDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLADAPPAAADAVTVARLKRAGA
VLVGRTNMSEFAFSGLGLNPHYGTPRSPYRRGVPGDERIAGGSSSGAAASVADGMAAVAL
ATDTGGSIRIPAALCGLTGFKPTASRIPKQGGVPLSTTLDSFGPIGVSVACCALVDRILA
GLEPHVSAARPLEGVRLGMLTNYVTDGVDAHVAASLDAALKHLEAAGAIVSDARFAPLDT
LPDINRFGFASIEAYAWHRPLVARHRDAYDPRVLARILRGEPASAADYLDLVAARAALID
EAARTVWQRFDALVAPTVPIAPPRIAELEQDDDAFTRMNALVLRNPSAFNFLDACALSLP
CHPRDTAPVGLMLAAAPHHDDALLAIGQAVEAVLATIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttcgcccccttcccgccgctcgcccgactcgccgccgacctcgccgccggc
acgacgacgagccgcgcgctcgtcgaagccgcgctcgaacggatcgccgatccggcggga
caaggcgcgctcgcattcaccgaggtcgacgcgcaaggcgcgcgcgccgccgccgacgcg
cacgatcgcctgcgcgcggcgggcaccgtgctgtcgccgctcgcgggcatcccggtgtcg
gtgaaagacctgttcgacgtcgcgggccaggtgacgcgcgcgggctcccgcgtgctagcc
gacgcgcccccggcggccgccgacgccgtcacggtcgcccgcctgaagcgcgcgggcgcc
gtgctcgtcggccgcacgaacatgagcgagttcgcgttctccggcctgggcctgaatccg
cactacggcacgccgcgctcgccgtaccggcgcggcgtgcctggcgacgagcggatcgcg
ggcggctcgtcgtcgggggcggccgcgtcggttgcggacggcatggcggccgtcgcgctc
gcgaccgacacgggcggctcgatccggattcccgccgcgctctgcgggctgacgggcttc
aagccgaccgcgagccggattccgaagcaaggcggcgtgccgctgtcgacgacgctcgat
tcgttcggcccgatcggcgtatcggtcgcgtgctgcgcgctcgtcgaccggattctcgcg
ggcctcgagccgcacgtgagcgccgcgcgtccgctcgaaggcgtacggctgggcatgctg
acgaactacgtgacggatggtgtcgacgcgcacgtcgcggcgtcgctcgacgccgcgctc
aagcatctcgaggcggcgggcgcgatcgtgtcggacgcgcgcttcgcgccgctcgacacg
ctgcccgacatcaaccgcttcggtttcgcttcgatcgaggcgtacgcgtggcatcgcccg
ctcgtcgcgcgccaccgcgacgcgtacgatccgcgcgtgctcgcgcgcatcctgaggggc
gagccggcgagcgccgccgattacctcgatctcgtcgccgcgcgcgcggcgctcatcgac
gaggcggcgcgcaccgtgtggcagcgcttcgacgcgctcgtcgcgccgacggtgcccatc
gcgccgccgcgcatcgccgagctcgaacaggacgacgacgcgttcacgcgcatgaacgcg
ctcgtgctgcgcaacccgagcgcgttcaattttctcgacgcgtgcgcgctgtcgctgccg
tgccatccgcgcgacacggcgcccgtcggcctgatgctcgccgccgcgccgcaccacgac
gacgcgctgctcgcgatcggccaggcggtcgaagcggtgctcgcgacgatccgctga

DBGET integrated database retrieval system