KEGG   Burkholderia sp. 2002721687: BW21_2273Help
Entry
BW21_2273         CDS       T03759                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01120  Microbial metabolism in diverse environments
bul01130  Biosynthesis of antibiotics
bul01200  Carbon metabolism
Module
bul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW21_2273 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BW21_2273 (sucA)
   00380 Tryptophan metabolism
    BW21_2273 (sucA)
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BW21_2273 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJY44290
UniProt: A0A0D5LM67
LinkDB All DBs
Position
I:complement(2512802..2515666)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSSASD
VAHNPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGVEFMYI
SDPEQKRWWQERLESSRATPNFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIASMDEVVQRAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLAQQGVISAEDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPQNFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNISE
GQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFANGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSARIERYLQLCAEHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVIACSGRVYY
DLVAHRREAKANDAAIVRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASVAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcaattccagctgaactcgtatctgttcggcggcaatgcttcg
tatgttgaagaactgtacgaagcctatttggataacccggcgtcggtgccggacaactgg
cgcgaatatttcgacgcgctgcaaaacgtccccgcaaccgatggttcgagcgcgagcgac
gtggcccacaacccgatcgtagagtcgttcgcccagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggcggcaacctcgccaccgcccgcaagcaagtccacgttcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctcgatcccctgaagcgccgc
gaacgccccgcgattcccgagctggaacccgcgttctacgatttctccgaagccgacctc
gaccagacgttcagcgcgagcaacctgtatttcgggttcgagcaggcgtcgctgcgcgac
atcgtcaaggggctgcgcgacacgtactgcggcacgatcggcgtcgaattcatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgcctcgagtcgagccgcgcgacgccg
aacttctcggccgacaagaagaagcacatcctgaaccgcctgacggccgccgaaggcctc
gagcgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcgtcgatggacgaagtcgtccagcgcgcaggctcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggcggatctcttcgccgaattcgagggcaagcacgtcgacgacctgccggcaggc
gacgtgaagtaccacaagggcttctcgtccgacatcgcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgagggctcc
gcgaaggcgcggatggaccgccgcggcgacgccgacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgccggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgacgcgcgctcgacgctgtactgcacggacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgtgctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcgggcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgctcagcacccaggcacccgcgcgctgtacgcggagaagcttgcgcag
cagggcgtgatcagcgccgaggacgccgacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgccgccgacaccgcggtgccgctc
gccgagctgaagcgcctcggcgaacgcatcacgacggtgccgcaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgatcagcccctc
gactggggcatgggcgagcacctcgcgtacgcatcgctcgtcgcgtccggctacgccgtg
cgcctgacgggccaggattcgggccgcggcacgttcacgcaccgtcatgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatctcggaa
ggccaagcgaagttcaacgtgatcgactcggtgctgtccgaagaggcggtgctcggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gatttcgcgaacggcgcgcaggtggtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctcacgatgctgctgccgcacggctatgaaggccagggtccg
gagcactcgtcggcgcgcatcgagcgctatctgcagttgtgcgcggagcacaacatgcag
gtcgtccagccgacgacgcccgcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctcatcgtcgcgacgccgaagtcgctgctgcgccacaaggaagct
gtgtcggatctgtcggagctcgcgaagggttcgttccagccggtgctcggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgatcgcgtgctcgggccgcgtgtactac
gacctcgtcgcgcatcgccgtgaagcgaaggcgaacgacgccgcgatcgtgcggatcgag
cagctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcaggggccgtggttctatgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcatc
gaaggcgcattcggccgcttgaagagcgcatcggtcgcgaaataa

DBGET integrated database retrieval system