KEGG   Burkholderia sp. 2002721687: BW21_2273Help
Entry
BW21_2273         CDS       T03759                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00020  Citrate cycle (TCA cycle)
bul00310  Lysine degradation
bul00380  Tryptophan metabolism
bul01100  Metabolic pathways
bul01110  Biosynthesis of secondary metabolites
bul01120  Microbial metabolism in diverse environments
bul01130  Biosynthesis of antibiotics
bul01200  Carbon metabolism
Module
bul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW21_2273 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BW21_2273 (sucA)
   00380 Tryptophan metabolism
    BW21_2273 (sucA)
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BW21_2273 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJY44290
UniProt: A0A0D5LM67
LinkDB All DBs
Position
I:complement(2512802..2515666)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSSASD
VAHNPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGVEFMYI
SDPEQKRWWQERLESSRATPNFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIASMDEVVQRAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLAQQGVISAEDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPQNFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNISE
GQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFANGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSARIERYLQLCAEHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVIACSGRVYY
DLVAHRREAKANDAAIVRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASVAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcaattccagctgaactcgtatctgttcggcggcaatgcttcg
tatgttgaagaactgtacgaagcctatttggataacccggcgtcggtgccggacaactgg
cgcgaatatttcgacgcgctgcaaaacgtccccgcaaccgatggttcgagcgcgagcgac
gtggcccacaacccgatcgtagagtcgttcgcccagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggcggcaacctcgccaccgcccgcaagcaagtccacgttcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctcgatcccctgaagcgccgc
gaacgccccgcgattcccgagctggaacccgcgttctacgatttctccgaagccgacctc
gaccagacgttcagcgcgagcaacctgtatttcgggttcgagcaggcgtcgctgcgcgac
atcgtcaaggggctgcgcgacacgtactgcggcacgatcggcgtcgaattcatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgcctcgagtcgagccgcgcgacgccg
aacttctcggccgacaagaagaagcacatcctgaaccgcctgacggccgccgaaggcctc
gagcgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcgtcgatggacgaagtcgtccagcgcgcaggctcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggcggatctcttcgccgaattcgagggcaagcacgtcgacgacctgccggcaggc
gacgtgaagtaccacaagggcttctcgtccgacatcgcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgagggctcc
gcgaaggcgcggatggaccgccgcggcgacgccgacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgccggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgacgcgcgctcgacgctgtactgcacggacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgtgctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcgggcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgctcagcacccaggcacccgcgcgctgtacgcggagaagcttgcgcag
cagggcgtgatcagcgccgaggacgccgacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgccgccgacaccgcggtgccgctc
gccgagctgaagcgcctcggcgaacgcatcacgacggtgccgcaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgatcagcccctc
gactggggcatgggcgagcacctcgcgtacgcatcgctcgtcgcgtccggctacgccgtg
cgcctgacgggccaggattcgggccgcggcacgttcacgcaccgtcatgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatctcggaa
ggccaagcgaagttcaacgtgatcgactcggtgctgtccgaagaggcggtgctcggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gatttcgcgaacggcgcgcaggtggtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctcacgatgctgctgccgcacggctatgaaggccagggtccg
gagcactcgtcggcgcgcatcgagcgctatctgcagttgtgcgcggagcacaacatgcag
gtcgtccagccgacgacgcccgcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctcatcgtcgcgacgccgaagtcgctgctgcgccacaaggaagct
gtgtcggatctgtcggagctcgcgaagggttcgttccagccggtgctcggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgatcgcgtgctcgggccgcgtgtactac
gacctcgtcgcgcatcgccgtgaagcgaaggcgaacgacgccgcgatcgtgcggatcgag
cagctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcaggggccgtggttctatgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcatc
gaaggcgcattcggccgcttgaagagcgcatcggtcgcgaaataa

DBGET integrated database retrieval system