KEGG   Burkholderia sp. 2002721687: BW21_2738Help
Entry
BW21_2738         CDS       T03759                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bul00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BW21_2738
Enzymes [BR:bul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BW21_2738
Transporters [BR:bul02000]
 Other Transporters
  Pores ion channels [TC:1]
   BW21_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJY42465
UniProt: A0A0D5LGZ0
LinkDB All DBs
Position
I:complement(3047647..3048303)
Genome map
AA seq 218 aa AA seqDB search
MLRLCGSPLSNYYNKVKFVLLEHDIPFDETLVKLPIDDPALLADMPLGKVPFLLTEHGSL
CESQAIVEYLAAIHSDKRIFPADPFDAAKAREITTVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFVHLPIVALATKAIYGRDFIA
DAGIDWKAYVKRIEEERPAAKRVRDERKAFIAGLAQQA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctctgtggctcaccgttgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgatattccgttcgacgaaacgcttgtcaagcttccgatcgacgatcccgcg
ctacttgccgacatgccgctcggcaaggtgccgtttctgctgaccgaacacggctcgctc
tgcgaatcgcaggcgatcgtcgaatatcttgccgcgatccattcggacaagcgcattttc
ccggccgacccgttcgacgcggcgaaggcgcgcgagatcacgacggtgctcgaactgtat
ctcgaatggaacgtgcgcgaactgtttccggaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctcgacggtttcaagcggctc
gcgaagttctcgccctacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
gtccatctgccgatcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcatcgcc
gacgccgggatcgactggaaggcatacgtgaagcgcatcgaggaagagcggccggcagcg
aagcgcgtgagagatgagcgcaaggcgttcatcgcggggctcgcgcagcaggcttga

DBGET integrated database retrieval system