KEGG   Burkholderia sp. 2002721687: BW21_3539Help
Entry
BW21_3539         CDS       T03759                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bul  Burkholderia sp. 2002721687
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW21_3539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bul02000]
    BW21_3539
Enzymes [BR:bul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BW21_3539
Transporters [BR:bul02000]
 Other Transporters
  Pores ion channels [TC:1]
   BW21_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2
Motif
Other DBs
NCBI-ProteinID: AJY43865
UniProt: A0A0D5LKY2
LinkDB All DBs
Position
I:complement(3940100..3940738)
Genome map
AA seq 212 aa AA seqDB search
MSSYRLYYSPGACSLAAHIALEETGAPFDAEPVRLSHREHLGERYLAINPKARVPALAIS
GEARVLTETPAILTYLARRHPDAALLPIDDPLREARCHEWLAWLVGWVHGVGYGALWRPG
RFAGDESIHPAISAHARRVIDEANGAIDAALRDGRQWAEPGGYSIVDPFLLVLYRWGCAI
GLDMGRRDAWSEHAARVSARDAAKRALATEGL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttatcgactctactattcgccgggcgcgtgctcgctcgccgcgcacatcgcg
ctcgaggaaaccggtgcgccgttcgatgccgagccagtgcgcctgtcgcatcgcgagcat
ctcggcgagcgctatctcgcgatcaatccgaaggcgcgcgtgcccgcgctcgcgatttcc
ggcgaagcgcgcgtgctgaccgagacgcccgcgatcctcacctatctcgcgcgccggcat
ccggacgccgcgctgctgccgatcgacgatccgctgcgcgaggcgcgttgccatgaatgg
ctcgcgtggctcgtcggctgggtgcacggcgtcggttacggcgcgctgtggcggccgggg
cggttcgccggcgacgaatcgattcatccggcgatctccgcgcacgcaaggcgcgtgatc
gacgaagcgaacggcgcgatcgacgcggcgctgcgcgacgggcggcaatgggcggagccg
ggcgggtattcgatcgtcgatccgttcctgctcgtgctgtatcggtgggggtgcgcgatc
gggctcgacatgggtcgacgcgatgcgtggagcgagcatgcggcgcgcgtctctgcgcgc
gatgcggcgaagcgggcgctcgcgacggaggggctgtag

DBGET integrated database retrieval system