KEGG   Burkholderia sp. 2002721687: BW21_3970Help
Entry
BW21_3970         CDS       T03759                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00250  Alanine, aspartate and glutamate metabolism
bul00410  beta-Alanine metabolism
bul00640  Propanoate metabolism
bul00650  Butanoate metabolism
bul01100  Metabolic pathways
bul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BW21_3970 (gabT)
   00650 Butanoate metabolism
    BW21_3970 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BW21_3970 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BW21_3970 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bul01007]
    BW21_3970 (gabT)
Enzymes [BR:bul01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BW21_3970 (gabT)
Amino acid related enzymes [BR:bul01007]
 Aminotransferase (transaminase)
  Class III
   BW21_3970 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJY38321
UniProt: A0A0D5L2M0
LinkDB All DBs
Position
II:402306..403589
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAGQLEQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALRGVSSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVCALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDARADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERANALGDKLKAKLAALRADVPQIADVRGPGAMVAAEFVD
PDTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIQDAVFDEALGILESVLK
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgagctgtgggacgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgaag
atcgtgaaggcgatcgccgggcagctcgagcagttcacgcacaccgcctatcagatcgtg
ccttacgcgtcgtacgtcgagctcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagccgtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcacgggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtatccgaacgcgctgcgcggcgtgtcgagcgcc
gattcgatcgccgccgtcgagacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgattatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtctgcgcgctgcgcaagctgtgcgacgcgcacggcatcctcctcatcgccgacgaagtg
cagacgggctttgcgcgcacgggcaagctgttcgcgatggagcactacgacgcgcgcgcc
gatctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgccgtcgccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaacgcgctcggcgacaagctcaaggcgaagctcgcggcattgcgcgccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccggacacgcgcgcgtccgacgccgcgttcacgaagcgcgtgcagacgctcgcgctcgaa
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacggttcctctttcct
ctcaccatccaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgaag
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system