KEGG   Burkholderia sp. 2002721687: BW21_4173Help
Entry
BW21_4173         CDS       T03759                                 

Gene name
ga1
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00500  Starch and sucrose metabolism
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BW21_4173 (ga1)
Enzymes [BR:bul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BW21_4173 (ga1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AJY40011
UniProt: A0A0D5L7B6
LinkDB All DBs
Position
II:664943..667588
Genome map
AA seq 881 aa AA seqDB search
MSAKHFGFKQAMLVGSLAALAGAALPPANASAAEAFGSPGATPVRGPSAKSFLGTAVGGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKLQAYSAAQTDARTMSW
QVTTSNSSHNWQIRKIVFADPNYNAIVQRVTFTALNGHNVGDFNLYMLSKPYLDNAGGNN
TAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGAGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQMGWIDLGDPGATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTAWHTYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDSN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNASGCAQGYS
RIGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIAAQNGDTASAARYLAAADYWQENVAAWTYT
SSGTFGNGSYYIRINPAGRAGAGTDRASFAPTAGPDTPQTLTVKNGGGNHDARRVVDGGF
FELVRMGVKRATDPTIVNTISVYDSVLGQTLSIANAPALSPNAWFRYNFDGYGEHNDGSD
FDGTGAGRLWPIFTAERGMVEIARQGSGNAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYAPGQPTKSMAPLNWAMGEYISLLASIQAGRIADVPSVVCARYSNCVAPL
QSGQVSVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPARYPVWSNTVNMPAGQA
IQYKYYRKNADGSVTWETWSGNRALQTPASGTLTLNDQVNW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaagcacttcggattcaaacaggcgatgctggttggcagtctggccgcgctc
gcgggcgcggcgctcccgccggcgaatgcttcggctgccgaagcatttggctcgcccggc
gcgacgcccgtgcgcggcccctcggccaagtcgttcctcggcacggcggtcggcggcgcg
tcgcgggtctacttcaccggctatcgcggcattctgtccgaggtctactatccggttctc
gacacgccggagtccgtcgacctgcagttcctcgtcggcgatgccggcaagaccttcgtc
gacgaagaaaagctgcaggcctactcggccgcgcaaacggacgcgcgcacgatgagctgg
caggtgacgaccagcaacagttcgcataactggcaaatccgcaagatcgtcttcgccgat
ccgaactacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccacaatgtc
ggcgacttcaatctctacatgctgtcgaagccgtacctcgacaacgccggcggcaacaac
acagcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaagtggtcaacggcgccggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggacgttctcgtccgcgaccaacggcaacgtcgcgcagatgggctggatc
gatctcggcgatccgggcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggatcaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgcgtggcacacctacgcggcgggcctgtcgtcgcagaacggc
gcggcggacgacggctactatctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgattcgaac
gcgggcggctatcacctcgtatggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggccggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctgcag
caaacgacggactgcggcaccgccgaatacaacgcatccggctgcgcgcagggctacagc
cgcatcgggcgcttcccgcagaacgcgtgggtgaacggctggccgtactggcaaggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgttgtggccgaagatcaagctcaccgccgactacatcgtcaacaccggcccttgg
acgtaccaggagcgctgggaagagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcagccgacatcgccgcgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcacgttcggcaacggcagctactacatccggatcaatccggcgggccgcgcg
ggcgccggcaccgatcgcgcgagcttcgcgcccaccgcaggcccggacacgccgcagacg
ctgaccgtgaagaacggcggcggcaaccacgatgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggcgtcaagcgcgcgaccgatccgacgatcgtcaacacgatc
tcggtctacgacagcgtgctcggccagacgctgagcatcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcagcgac
ttcgacggcaccggcgccggccgactgtggccgatcttcaccgccgagcgcgggatggtg
gagatcgcgcgccagggcagcggcaacgcgggcagcgcgtacttctcgacgctcaagcaa
ctgacgacgcccgagggcttcgtgccggagcaggtatggtcgaattcgacgacgctgccc
gacggctgggcagtgacgacgcccgccggctacgcgccggggcagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgagtacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgccgacgtgccgtcggtggtctgcgcgcgctacagcaactgcgtcgcgccgctg
cagagcgggcaggtgtcggtggcggtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacgggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgacccggcccgttacccggtgtggagcaacaccgtcaacatgccggccggtcaggcg
atccagtacaagtactatcggaaaaacgcggacggcagcgtgacgtgggaaacctggtcg
ggcaaccgagcgcttcagacgcccgcgagcggcacgttgacgctgaacgatcaggtgaac
tggtga

DBGET integrated database retrieval system