KEGG   Burkholderia sp. 2002721687: BW21_4639Help
Entry
BW21_4639         CDS       T03759                                 

Definition
(GenBank) ring hydroxylating alpha subunit family protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00627  Aminobenzoate degradation
bul01100  Metabolic pathways
bul01120  Microbial metabolism in diverse environments
Module
bul_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BW21_4639
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BW21_4639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AJY38938
UniProt: A0A0D5L4E2
LinkDB All DBs
Position
II:1211384..1212661
Genome map
AA seq 425 aa AA seqDB search
MDPTESPVILIDHTDSSDVRFPHDDGSRVPYKVFSSQAVYDREQERIFRGQTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRREDGTLAAWVNRCAHRGAQVCRKARGNASSHTCVYHQW
SFDSQGNLLGVPFRRGQKGMAGMPADFDPKNHGLRKLQVDSYKGLVFATFSDAVAPLPDY
LGAQMRPWIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTRDDADTATAYKQQNIRSFDEGFSLEDDSILALVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIRQAN
LVGPAGYISMEDTEATELVQRGTVRDAHAASVIEMSRGNPDQQDTAITESLIRKFWVGYQ
QLMGY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaccgaatctccagtgatactgatcgatcacaccgattcgtccgacgtgcga
ttcccgcacgacgacggctcgcgcgtgccgtacaaggtgttcagctcgcaagcggtgtac
gaccgcgagcaggagcgaatcttccgcgggcagacgtggaatttcgtcgcgctcgaagcg
gaaatcccgaagccgggcgacttcaagagcacgttcgtcggcgatacgcccgtcgtcgtc
acgcgccgcgaggacggcacactcgccgcgtgggtgaaccgctgcgcgcatcgcggcgcg
caggtgtgccgcaaggcgcgcggcaacgcaagctcgcacacgtgcgtatatcaccaatgg
agcttcgacagccaaggcaacctgctcggcgtgccgttccggcgcggccagaagggcatg
gccggaatgcccgcggatttcgatccgaaaaaccacgggctgcgcaagctgcaagtcgac
agctacaagggcctcgtgttcgcgacgttcagcgacgccgtcgcgccgctacccgattac
ctcggcgcgcagatgcggccgtggatcgaccggatcttccacaagccgatcgagtatctc
ggctgcacacggcagttctcgaaatcgaactggaagctgtacttcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgacgttcaacatcttccgcgtcggg
atgaaggcgcgttcgatcccggacgcgacgcacgggctgcacagcatcatcacgatgacg
aagacgcgcgacgacgcggacaccgcgaccgcgtacaagcagcagaacatccgttcgttc
gacgaaggtttttcgctcgaggacgattcgatcctcgcgctggtatccgaatacgacgag
gacacgacgaatcatatccagccgatcttcccgcagctcgtgatccagcagatccacaac
acgctcgtcgcgcgccaactgctgccgaaggggccgaagaacttcgagctgatcttccac
ttcttcggctacgcggacgacacgcccgagctgcgcgatttgcggatcaggcaggcaaac
ctcgtcgggcccgccggctatatctcgatggaggacaccgaggcgaccgagctcgtccag
cgcggcaccgtgcgcgatgcgcacgcggcgtcggtgatcgagatgtcgcgcggcaatccg
gaccagcaggacacggcgatcaccgaaagcctgatccgcaagttctgggtcggctaccag
cagttgatgggctattga

DBGET integrated database retrieval system