KEGG   Burkholderia sp. 2002721687: BW21_5730Help
Entry
BW21_5730         CDS       T03759                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00040  Pentose and glucuronate interconversions
bul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BW21_5730
Enzymes [BR:bul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BW21_5730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C DAO Ldh_1_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJY38988
UniProt: A0A0D5L4I1
LinkDB All DBs
Position
II:2439459..2440493
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARDLALRDIDLPLDVGPSDVKIRIHTVGVCGSDVHYYTHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGIPRFDSRATLHGLYNLDPSVRFWATPPVHG
CLTPYVVHPAAFTYRLPENVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFASNRAVTTVDASTQSLAEAVARETDGWGADVVFE
ASGNAKAYAGIVDLLCPNGCLVLVGMPLDPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgacctcgcgctgcgcgacatcgacctgccg
ctcgatgtcggcccgtccgacgtcaagatccgcatccacacggtgggcgtgtgcggcagc
gacgtccactactacacgcacggcggaatcggcccgttccgggtcgacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtctgcatggagcccggcatcccgcgcttcgattcaagagcgacgctg
cacggcctctacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggc
tgcttgacgccctacgtcgtgcatccggcggcgttcacgtaccggctgccggagaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaaa
gcggcgatgaagccgggcgacatcgccgtcgtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgattcttgccgatgtcgtcaag
gagaagctcgcgctgttcgcgtcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgaagcggtcgcgcgcgaaaccgacggctggggcgcggatgtcgtgttcgag
gcaagcggcaatgcgaaggcgtatgcggggatcgtcgacctgctgtgcccgaacggctgc
ctcgtgctggtcgggatgccgctcgatccggtgccgctcgacgtcgtctcgctgcaggcg
aaggaagcgcggatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcgtccggcgcgatcgacgtgaagccgttcatttcgcgcacgttcccgttctcg
gacggcctgcgcgcgttcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system