KEGG   Burkholderia sp. 2002721687: BW21_866
Entry
BW21_866          CDS       T03759                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bul  Burkholderia sp. 2002721687
Brite
KEGG Orthology (KO) [BR:bul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BW21_866
Enzymes [BR:bul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BW21_866
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: AJY43135
UniProt: A0A0D5LIU1
LinkDB
Position
I:complement(922968..923795)
AA seq 275 aa
MTDRHASASPFRVAALQMVSTPDRERNLAEAGRLIADAAGAGVRLVLLPEYFCFMGHQDT
DKLALAEAYQDGPIQRFLAGRAKAHGVWVIGGTLPLSAPEPSRVLNTTLVFDPQGREAAR
YDKIHLFNFEKDDESFDEARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAM
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGQHENGRRTWGHSMLVDPWGEIV
AVRDEGAGVVAGEIDPARIADVRRSLPAWRHRVLE
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaccgatcgccatgcctcagcctcgccgttccgggtcgccgcgctgcagatggtcagc
acgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgacgcggcgggc
gcgggcgtgcggctcgtgctgctgcccgaatacttctgcttcatgggccaccaggacacc
gacaagctcgcgctcgcggaagcctaccaggacggcccgatccagcgctttctcgccggg
cgcgcgaaggcgcacggcgtctgggtgatcggcggcacgctgccgctctcggcgcccgag
ccttcgcgcgtgctgaacacgacgctcgtgttcgatccgcagggccgcgaggccgcccgc
tacgacaagatccacctgttcaacttcgagaaggacgacgagtcgttcgacgaggcgcgc
acgatccgtccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgggtcgggctg
tcggtctgctacgatctgcgctttccggagctgtaccggcgaatgggggactgcgcgatg
atcgtcgtgccgtcggcgttcacgtacacaacgggccgcgcgcactgggagacgctgttg
cgcgcccgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggcggccagcac
gagaacggccgccgcacgtggggccacagcatgctcgtcgacccgtggggcgagatcgtc
gcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgagatcgatcccgcgcggatcgcc
gacgtgcggcggagcctgcccgcgtggcggcaccgtgtgctcgaatga

DBGET integrated database retrieval system