KEGG   Burkholderia sp. PAMC 26561: AXG89_03575Help
Entry
AXG89_03575       CDS       T05481                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00061  Fatty acid biosynthesis
bum00071  Fatty acid degradation
bum01100  Metabolic pathways
bum01212  Fatty acid metabolism
bum02024  Quorum sensing
Module
bum_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXG89_03575
   00071 Fatty acid degradation
    AXG89_03575
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXG89_03575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bum01004]
    AXG89_03575
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bum04147]
    AXG89_03575
Enzymes [BR:bum01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AXG89_03575
Lipid biosynthesis proteins [BR:bum01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AXG89_03575
Exosome [BR:bum04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AXG89_03575
  Exosomal proteins of breast cancer cells
   AXG89_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AME23051
UniProt: A0A0X8L365
LinkDB All DBs
Position
1:complement(778710..780383)
Genome map
AA seq 557 aa AA seqDB search
MEKIWLKSYPAGVPEEIDATRYNSLSDLLLESFRENRSKRAFVCMGKAITYGELDAVSTR
LAAWFQARGLKPGARIAIMMPNVLQYPVAIAAILRAGYVVVNVNPLYTPRELEHQLQDSG
AQAIVVLENFAHTVQSVVKNTAIEHVVVATMGDLMGVKGMIVNFVVRKVKKLVPAWNLPG
HVSFNTALRQGASETLKPVSQGPDDIAFLQYTGGTTGVAKGAMLLHRNLIANVLQSEVWL
EPGRRNRPDIDQFISVVALPLYHIFALTVCGFLTIRTGGMGILIPNPRDIPGTIKELKGF
PINTFPAVNTLYNALLNNPEFAKLDFSKLIAANGGGMAVQEAVAKRWFEITGSPIIEGYG
LSETSPCVTCNPVTATEYTGTIGLPFPSTEISIRDDDDREVPLGQPGEVCIRGPQVMAGY
WNRPDETAKVMTPDGFFKSGDVGVMDERGYVKIVDRKKDMILVSGFNVYPNEIEDVVAKL
PGVFEVAAVGVKDAASGEAVKLFVVRRDPHLTEADVIAYCKERLTGYKRPRVIEFRTELP
KSNVGKILRRELRDGNA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatctggctgaagtcctatccggcaggcgtgcccgaggaaatcgatgcaacc
cgctacaactcgctttccgatctgctgctggagagcttccgcgaaaatcgcagcaagcgc
gcgtttgtctgcatgggcaaagccatcacgtatggcgagctcgacgcagtctcgacccgg
ctcgccgcctggttccaggcacgtggcctgaaaccaggcgcgcgcatcgcgatcatgatg
cccaacgtgctgcaatatcccgttgcgatcgcggcgatcttgcgggcggggtatgtggtc
gtgaacgtgaatccgctttacacgccgcgcgaactcgaacaccagttgcaggattccggc
gcgcaggccatcgtcgtgctcgaaaacttcgcgcataccgtgcagtcggtcgtcaaaaac
acagcgatcgaacacgtcgtggttgccacgatgggcgacctgatgggcgtgaaaggcatg
atcgtcaatttcgtcgtgcgcaaggtgaagaagctcgtgcccgcatggaatcttccgggc
cacgtgagcttcaacacggcgcttcggcaaggcgcgagcgaaacgctcaagcccgtcagc
cagggaccggacgacatcgctttcctccagtacacgggtggcacgaccggcgtggcgaag
ggcgcaatgttgctgcatcggaacttgattgcgaacgtcctgcagtcggaagtgtggctt
gaacccggacgcaggaaccggcctgatatcgaccagttcatcagtgtcgtggcgctgccg
ctttatcacatctttgcgctgacggtttgtggcttcctcaccatcaggaccggcggcatg
ggcatcctgattccgaatccacgcgatatccccggcacgatcaaggagctcaaaggcttc
ccgatcaacaccttcccggccgtcaacacgctctacaacgcgttgctgaacaacccggaa
ttcgcgaagctggatttctcgaagctgattgcggcgaatggcggcggcatggcggtgcag
gaagccgtggcgaagcgctggttcgagataacggggtcgccgattatcgaagggtatggg
ttgtccgagacatcgccgtgcgtgacgtgcaatccggtgaccgccacggaatataccggg
acgatcgggttgccgtttccatcgactgaaatctccattcgcgatgacgacgaccgcgaa
gtgccgctcggccagccgggcgaggtctgcattcgcggaccgcaagtgatggcgggctac
tggaatcgtcccgacgaaaccgcgaaagtaatgacgcccgacggcttcttcaaatccggc
gacgtcggcgtgatggacgagcgcggttacgtgaagatcgtcgaccggaagaaggacatg
atcctggtgtcgggcttcaacgtgtatccgaacgagatcgaggacgtggtggccaagctt
ccgggcgtgttcgaagtggctgccgtcggcgtaaaggacgcggcatcgggcgaagcggtg
aagctgtttgtcgtgcggcgggacccgcacctgactgaagcggacgtcattgcttattgc
aaggagcggctgaccggatacaagcggcctcgggtgatcgaattccgtacggaattgccc
aagagcaacgttggcaaaattctgcgccgcgagttgcgcgacggcaacgcctga

DBGET integrated database retrieval system