KEGG   Burkholderia sp. PAMC 26561: AXG89_09825Help
Entry
AXG89_09825       CDS       T05481                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bum  Burkholderia sp. PAMC 26561
Pathway
bum00620  Pyruvate metabolism
bum00680  Methane metabolism
bum00710  Carbon fixation in photosynthetic organisms
bum01100  Metabolic pathways
bum01120  Microbial metabolism in diverse environments
bum01200  Carbon metabolism
Module
bum_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXG89_09825
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AXG89_09825
   00680 Methane metabolism
    AXG89_09825
Enzymes [BR:bum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AXG89_09825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AME24098
UniProt: A0A0X8L569
LinkDB All DBs
Position
1:complement(2139007..2142006)
Genome map
AA seq 999 aa AA seqDB search
MTSPGSARNARPRRNAVSKNEGSSVKAIAADVTVAAKASKARATAVKKPAVKEPAAKAAS
KPPKAASRTRDDKDLPLFEDIRYLGRLLGDVVREQEGDKVFDVVETIRQTAVKFRREEDS
EASQALDKRLKSLSPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSTPQAGTMA
YAIERLKASPDASSAQATLQKFFDAALIVPVLTAHPTEVSRKSILDAQHEVARLLAERDQ
DLTTRERAHNESMLRARVTSLWQTRMLREARLTVADEIENALSYYRATFLEEIPALYADI
EAALAEHGLPARLPPFLQMGSWIGGDRDGNPNVTAPTLVHAITRQATVIFEHYLEQVHKL
GAELSVSNLLAGASAELKKLADNSPDASPHRTDEPYRRALIGVYARLVASADERLGAGVV
AARSRHPAKPYASATEFAADLNVLIESLAAHHGEYLSAPRLSPLARAAEVFGFHLASIDL
RQSSDIHEAVIAELLAHAGVQDDYAALPEADKVALLLNELAQPRPLRLPYFDYSDLAKSE
LGVLEAARVTREKFGTRAVRNYIISHTETVSDLLEVMLLQKETGLLQGRLGHAKDPAHDG
LMVIPLFETIADLRNAPHIMGDFFALPGVNKLVELQGGEQEVMLGYSDSNKDGGFLTSNW
ELYRAELALVALFKQHKTTLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRTTEQGE
VIASKFGNPEIGRRNLELVVAATLEASLLPHENTPAQLPAFEATMQTLSDSAMAAYRALV
YETPGFKEYFFESTPISEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLL
TGWYGFGSAVTNFLDTASDAAERARRLATLKKMHKTWPFFANLLSNMDMVLAKTDIAVAS
RYAQLVTDKKLRKHVFSRIVAEWERTSSVLSEITGHSERLANNPLLARSIKNRFPYLDPL
NHLQVELLKRHRAGDDNVRLGRGIHLTINGIAAGLRNTG
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcccggatcggcgcgcaatgcccgcccccgccgcaacgcggtatcgaagaat
gaaggttcgtccgtcaaggccatcgcggccgatgtaacggttgccgccaaagcctccaag
gcgcgcgccaccgccgtcaagaagcctgctgtgaaagagcccgctgcgaaggctgccagt
aagccgcccaaagccgcatcgcgtacacgcgacgacaaggaccttcccctcttcgaggac
atccgctatctcggccgcctgctcggcgacgtcgtgcgcgaacaggaaggcgacaaggtc
ttcgatgtcgtcgaaacgattcgtcagaccgcggtcaagtttcgccgtgaggaagacagc
gaggcatcgcaggcgctggacaagcgcctgaaatcgctttcgcccgagcagactgtgagc
gtcgtgcgcgcgttcagctatttctcgcatctggcgaatatcgccgaggaccggcatcac
aaccggcgccgcaggattcatgcgctcgccggctcgacgccgcaggccggcacgatggct
tatgcaatcgagcggctgaaagcgagtcccgatgcttcatcggcgcaggcgacgctccag
aagttcttcgatgccgccctgatcgtgcccgtactgaccgcgcaccccacggaagtctcg
cgcaagagcattctggatgcacagcacgaagttgcgcggctgctggccgaacgcgatcag
gacctgacgacacgcgaacgcgcgcacaacgagtcgatgctgcgcgcccgcgtcacgtcg
ctctggcaaacgcggatgttgcgcgaagcgcgcctgaccgtcgccgatgaaatcgaaaat
gcgctttcgtattatcgtgcaacgttcctcgaagaaattcctgcgctttacgctgatata
gaagccgcgctcgccgagcacggactgcccgcgcgcctgcccccgttcctgcaaatggga
agctggattggcggagatcgcgacggcaatccgaacgtcaccgcgcccacgctggttcac
gccatcacgcgccaggccacggtgattttcgaacattacctggagcaggtgcataagctc
ggcgcggaactatcggtgtcgaacttgctggccggcgcaagcgccgaactcaagaaactc
gccgataactccccggatgcgtcgccgcatcgtaccgatgagccttatcggcgcgcgctg
atcggcgtgtacgcaaggctcgtcgcgtccgccgacgaacgtctgggcgcgggcgtggtc
gcagcgcgcagccgtcatccggcgaagccgtatgcatcggcaactgagtttgccgccgat
ctgaacgtgctgatcgaatcgctcgccgcgcatcacggcgagtatctttcggcgccgcgc
ttgtcgcctttggcgcgcgcggccgaagtgttcggcttccatctggcgagtatcgatttg
cgtcagagctcggacattcacgaagcggtgatcgcggagttgctggcgcacgcaggcgtg
caggacgattacgccgcgctgcccgaagccgataaagtcgcgttgctgctcaacgaactg
gcccagccgcggccgctgcgcctgccgtatttcgattactcggatctcgctaagagcgaa
ctcggcgtgctcgaagcggcgcgcgtgacgcgtgagaaattcggtacgcgggccgtgcgc
aactacatcatttcgcatacagaaacggtcagcgacttgcttgaagtgatgctgctgcaa
aaggaaaccggcctgctgcaggggcgtctcggacacgcgaaagatcccgcgcacgatggc
ctcatggtgattccgctgttcgaaaccatcgccgacttgcgcaacgcgccgcacatcatg
ggcgacttcttcgcgctgccgggcgtgaacaagctggtcgagctgcaaggcggcgagcag
gaagtcatgctgggttactccgacagcaacaaggacggcggttttcttacgtcgaactgg
gagttgtatcgcgcggaactggcgctggtcgcgttgttcaagcagcacaagaccaccttg
cgcctttttcacggccgtgggggcacggtcggtcgcggaggcggtccgacgtatcaggca
atcctgtcacagccgccagggacggtagatggccagatccgcacgaccgagcaaggcgaa
gtgatcgcgagcaaattcggcaatccagagatcgggcggcgcaatctcgagctcgtggtg
gcggcgacgctcgaagcttcgctcttgccgcacgaaaatacgccggcgcagttgcccgcg
ttcgaagcaaccatgcagacgctgtcggattcggcgatggccgcgtatcgtgcgctggtt
tatgaaacgcccggattcaaggagtatttcttcgaatcgacgccgatttcggagatcgcg
gagctgaacatcggcagccggccggcatcgcgaaaattgcaggatccgaagcaacgcaag
atcgaggatctgcgggcgattccgtggggcttttcgtggggccaatgccgtctgcttctg
acgggatggtatggcttcggcagcgcggtcacgaatttcctcgataccgcgtccgacgcc
gccgagcgcgcgaggcggctcgccacgctcaagaagatgcacaagacctggccgttcttc
gcgaacctgctctcgaacatggacatggtcctggcgaagacggacattgcggtggcatcg
cgttacgcgcaactcgtcaccgataaaaaactccgcaagcacgtgttcagccggatcgtg
gcggaatgggagcggacgtcgagcgtgttgtcggagatcacggggcacagcgagcggctc
gcgaacaacccgctgctcgcgcggtcgatcaagaaccgcttcccgtatctggacccgctg
aatcacttgcaggtggagttgctgaaacggcaccgcgcgggggatgacaacgtgcggctg
ggacgcgggattcacttgaccatcaacgggattgcggcggggttgcgtaatacgggttga

DBGET integrated database retrieval system